Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
Experience in Schema modelling Should be aware of Agile Scrum Lean practices SDLC Methodologies Should have Performed Architecture Design Code reviews Knowledge of the finance markets and financial ...
financedatabasemigrationarchitectureshellscriptingqueriescommunicationstakeholdermanagementscrumtroubleshootingcleperfmancetuning8.0 Year(s) To 15.0 Year(s) Job Profile Regular Shift 5 PM IST 2 AM IST Cab facility will be provided We need an SME , who has solid hands on experience on all mandatory skills . candidate should b...
shellscriptingdatabasemigrationbusinessconsultingtechnologyservicesaixsmecledbaitservicesmusicmakingacledatabaseperfmancetuningmaterializedviewssoftwareinstallationcabAnalyze business requirement then design and developed datamart objects To deliver Report Catalogue Reporting architecture design solution for a Murex reporting Analyze and optimize the feeders A...
documentationbusinessrequirementsbusinessanalysisdatabasemigrationarchitecturaldesignsqlxmljspnetmurexdesignscienceustomerrelationsrequirementsfunctionalcompbinaryaspnetfeedersbusinessSkills C, C , Java, JSP, XML, dot net, ASP. Net, SQL,PL/SQL Domain Financial Services Capital markets, Derivatives Roles and Responsibility Analyze business requirement then design and developed data...
documentationbusinessrequirementscapitalmarketsfinancialservicesdatabasemigrationarchitecturaldesignsqlxmlnetaspjspjavaustomerrelationsrequirementsfunctionalaspnetquantitativemanagementdotSkills C, C , Java, JSP, XML, dot net, ASP. Net, SQL, PL/ SQL Domain Financial Services Capital markets, Derivatives Roles and Responsibility Analyze business requirement then design and developed da...
documentationbusinessrequirementscapitalmarketsfinancialservicesdatabasemigrationarchitecturaldesignsqlxmlnetaspjspjavaustomerrelationsrequirementsfunctionalaspnetquantitativemanagementdotPosition Murex Business Analyst Relevant experience 2 - 7 years of IT experience Qualification B.Tech, Comp Science, MCA Skills C, C++, Java, JSP, XML, dot net, ASP. Net, SQL, PL/ SQL Domain Financial...
documentationbusinessrequirementscapitalmarketsbusinessanalysisfinancialservicesdatabasemigrationarchitecturaldesignsqlxmlnetustomerrelationsrequirementsfunctionalquantitativemanagement
About Accenture: Accenture Technology powers our clients businesses with innovative technologies established and emerging changing the way their people and customers experience work, life and e...
businessprocesscapacityplanningdatabasemigrationcommunicationskillssoftwareengineeringawsriskcloudertifiedtipstrainercomplexsystemsperfmancetuningclustermanagementtechnologyplatfprofessionalliability
This role requires a wide variety of strengths and capabilities, including:
Digital/ Custom/ RF PDK Development position. The job responsibilities for this position are to perform Digital / Custom / Analog / RF PDK development as well as provide user support for circuit simul...
pdkdesignsciencesimulationpdkdevelopmentcomputersciencedatabasemigrationircuitdatabaseannotationusersuppPerform preventative maintenance on data center according to schedule and ensure effective working of mechanical building systems. Maintain all operations systems and perform all emergency functions ...
ticketingoperationstoolsproductionwarrantysgmlbasicsystemfederalsystemssupportmechanicalmaintenanceworkflowenglishstateriterdatabaseadministrationdatatransformationservicesdatabasemirroringdatabasemigrationcentralcapacityplanningExperience in Schema modelling Should be aware of Agile Scrum Lean practices SDLC Methodologies Should have Performed Architecture Design Code reviews Knowledge of the finance markets and financial ...
financedatabasemigrationarchitectureshellscriptingqueriescommunicationstakeholdermanagementscrumtroubleshootingcleperfmancetuningPerform preventative maintenance on data center according to schedule and ensure effective working of mechanical building systems. Maintain all operations systems and perform all emergency functions ...
ticketingoperationstoolsproductionwarrantysgmlbasicsystemfederalsystemssupportmechanicalmaintenanceworkflowenglishstateriterdatabaseadministrationdatatransformationservicesdatabasemirroringdatabasemigrationcentralcapacityplanning© 2019 Hireejobs All Rights Reserved