documentation skill jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

documentation skill Job Openings

Showing 30001 - 30050 of 31340 Jobs

Apply for Area Sales Manager - Chandigarh

Foursis Technical Solution 5.00 to 10.00 Years Chandigarh 23 Sep, 2023

Job functions area :

Location :

Experience :

Skills :

.NET Azure Developer

HARJAI COMPUTERS PRIVATE LIMITED 6.00 to 9.00 Years Chennai 23 Sep, 2023

.net

jira

Servicenow Developer

Wipro Technologies 7.00 to 12.00 Years Chennai 23 Sep, 2023

Key Responsibilities:

ServiceNow Development: scriptingapiservicenow

Senior Data Analyst
HARJAI COMPUTERS PRIVATE LIMITED 0.00 to 2.00 Years Chennai 23 Sep, 2023

Skill - SSE - Data Analyst Exp - 4 to 7 Years Location - Pan India Budget - Exp * 4 or 4.5 Shift - 9 to 6 REQ - Perm Notice Period - Immediate to 10 Days Mandatory Skills - Pandas, Lambda, ...
data analysisnlppanda

Lead Engineer - Body Systems
Mahindra business & consulting services pvt ltd 9.00 to 12.00 Years Chennai 23 Sep, 2023

Experience in Sheet metal design of Upper Body / Closures / Underbody / Cargo / Body fittings Demonstrates in depth knowledge of all the system specific CAD modules using CATIAV5 ( Surfa...
javacustomer relationslinuxautomationsheet metal designcontinuous improvement facilitationsheet metalpart designsystem designsolid modelingassembly design

Req. now Senior Manager(L5) - Project Execution Press & BIW
Tata Motors Ltd 3.00 to 5.00 Years Chennai 23 Sep, 2023

Position Summary with Job Responsibilities Brief Role Description (one line description including travel if any) : Responsible for Equipment Engineering, System Integration, Inst...
financesalesltdmisaccountancyregulatory auditssystem integrationmanufacturing processsapplcplmbiw

Content Writer - Ahmedabad
Foursis Technical Solution 0.00 to 1.00 Years Ahmedabad 23 Sep, 2023

Job functions area : Content Writer / Journalism Location : Ahmedabad Experience : 0 - 1 years Skills : RESEARCH, GOOD ...
content managementeditingseowritingweb site productionresearchcommunicationQualitative ResearchLecturing

SLP Manager, Security & loss Prevention
Amazon 3.00 to 5.00 Years Ahmedabad 23 Sep, 2023

The primary objective of the Security & Loss Prevention coordinator is to ensure the protection of people & assets of Amazon s MM in accordance with global Security guidelines and Policies The rol...
control roomnew projectsprocess reviewloss preventionlaw enforcementasset protectioncorrective actionprocess improvementinformation securitypreventive maintenancesecurity investigationsamccareslascapascrapstores

ON SPOT OFFER - SALES HERO - HIGH CTC - ALL INDIA - NORTH - SOUTH - EAST - WEST
RELIANCE NIPPON LIFE INSURANCE COMPANY LIMITED 2.00 to 7.00 Years Ahmedabad 23 Sep, 2023

Greetings from Reliance Nippon Life Insurance! Reliance Nippon Life Insurance is one of Indias leading private sector financial services companies, which ranks among the top pri...
field workdirect saleslife insuranceagency developmentinsurance salesagency channelagency salesdirect marketing

Deputy General Manager EV Projects
Tata Motors Ltd 12.00 to 14.00 Years Ahmedabad 23 Sep, 2023

Position Summary with Job Responsibilities Position Name DGM Project Planning & Execution - EV Operation Requisition ID Location (City/Region) Ahmedabad Plant Position Code ...
salesmarketingbusiness developmentmanagementinspiring teamsproject planning

LTIMindtree hiring for Ahmedabad location
LTIMindtree Limited 5.00 to 8.00 Years Ahmedabad 23 Sep, 2023

Job Title:Java Full Stack Developer Responsibilities - Collaborate with onsite developers and stakeholders over the development of new features and enhancements - Support prod...
angularjava

Hiring Office Administrator for a Leading Pharma Industry - Ahmedabad Location
POST A RESUME 1.00 to 3.00 Years Ahmedabad 23 Sep, 2023

Job Overview: We are seeking a highly organized and detail-oriented Office Administrator to ensure the smooth day-to-day operations of our office. The ideal candidate will be a ...
administration managementgeneral administration

Tech Architect Magento- Ahmedabad
LTIMindtree Limited 12.00 to 17.00 Years Ahmedabad 23 Sep, 2023

Key Responsibility: # Designing and leading B2B, B2C, multi-site and multi-country, end-to-end implementations of eCommerce platforms # Contribute effectively in defining the architecture/desi...
magentoarchitect

Modern Trade Executive
EG KANTAWALA PRIVATE LIMITED 2.00 to 5.00 Years Mumbai City 22 Sep, 2023

Knowledge & Skill: Sales Experience, Good Communication skills, Technical knowledge, MS Office Industrial Products, Weighing Scales, Automation field, B2B, Relationship Building...
product placementnew business development

Autocad Designer
ARYAN TECHNOLOGY 0.00 to 4.00 Years Mumbai City 22 Sep, 2023

Duties and responsibilities

Develop store designs for new stores and remodels with a creative and problem-solving approach while adhering to brand standards

Work coll...
ms officeconcept modelingclass a surfacingsurface modelingsolid modelingcad3d modeling

Virtual Relationship Manager
SKILLLABS RESOURCE SERVICES PRIVATE LIMITED 1.00 to 6.00 Years Navi Mumbai 22 Sep, 2023

Dear All, Greetings from Skill Labs ! We have a fantastic opportunity for Bankers. Job title: Virtual Relationship Manager Location: Mumbai ...
telecom salesphone bankingcasa salescasabranch bankingtelesalessales

Oracle Dba Consultant - 30 Days
LTIMindtree Limited 4.00 to 9.00 Years Mumbai City 22 Sep, 2023

Mandatory Skills:

Experience on RAC

Multi-Tenancy(PDB/CDB)

DB migration

Performance Tuning

TDE Wallets
rmangolden gateocimigrationraccdbtde

req. for Application Architect Mobile
IBM India Pvt Limited 12.00 to 16.00 Years Mumbai City 22 Sep, 2023

Introduction As an IBM Application Architect, you directly help clients transform their business and solve complex problems. You will define the scope and vision for projects that deliver customiz...
javasapreportingapistrong communication skillsmobile application developmentlife cycleobjective cdesign thinking

Sr. Manager - Medical Services
LUPIN 5.00 to 10.00 Years Mumbai City 22 Sep, 2023

Qualification: MD / MS / MBBS / PhD Pharmacology with Respiratory experience Revant Experience: 5-10yrs. Skill Set: Medico Marketing Key Responsibilities: - Keeping a cl...
medico marketingproduct managementiiistrategyplanninganalysisclinicalmarketingmanagementassessmentpharmacologyconsultationProduct StrategyProduct PlanningMarket Requirements DocumentsProduct RequirementsConsumer Electronicsmedical

Bus Process Delivery Associate-Transaction risk management
Accenture 1.00 to 3.00 Years Mumbai City 22 Sep, 2023

Job Skill:Anti-Money Laundering (AML)

Designation: Management Level - Associate

Job Location: Mumbai accountsbillingbilling systemscmscomanti money launderingfraud claimsdue diligencecapital marketrisk managementproblem solvinghelping clientsbusiness processsystem managementfinancial servicesprofessional servicesbusiness requirementskyc

SW Project Manager 2023
Bosch Group 3.00 to 5.00 Years Bangalore 22 Sep, 2023

Job Description

Coordinate internal resources and third parties/vendors for the flawless execution of projects

Ensure that all projects are delivered on-time, within scope and wi...
deliveryproject managementcustomer relationsreportingjavaproject plansrisk management

apply now Vehicle Computer- Functional Safety Engineer
Bosch Group 3.00 to 5.00 Years Bangalore 22 Sep, 2023

Job Description Mandatory skills:

Very Good understanding of ISO 26262 safety dev process

Hand-on experience of working on Microprocessor domain

Good ...
safetyfirst aidinspectionsiterisk assessmentsoftware engineeringprogramming languagestechnical documentationautomotive locksmithingagile scrum

Senior System Engineer
Merck Ltd 4.00 to 9.00 Years Bangalore 22 Sep, 2023

Work Your Magic with us! Ready to explore, break barriers, and discover more We know you ve got big plans so do we! Our colleagues across the globe love innovating with science and technology...
sqljavaunixtroubleshootingcustomer relationswindows server osroot cause analysisserver osit supportroot causeglobal changewindows serveractive directorypatch managementchange managementproblem managementdirectory servicesoperational suppo

Req. now Senior Manager(L5) - Project Execution Press & BIW
Tata Motors Ltd 3.00 to 5.00 Years Bangalore 22 Sep, 2023

Position Summary with Job Responsibilities Brief Role Description (one line description including travel if any) : Responsible for Equipment Engineering, System Integration, Inst...
financesalesltdmisaccountancyregulatory auditssystem integrationmanufacturing processsapplcplmbiw

Assistant Sales Manager
Jobs Territory 0.00 to 4.00 Years Bangalore 22 Sep, 2023

Designation: Asst. Sales Manager Branch Office Locations: Kharghar, Powai, Andheri, Borivali, Pune, Gurgaon, Bangalore. Candidates Profile: G...
direct salesmarketingreal estate sales

Manager- FRAS
Techenergo Engineering Services LLP 5.00 to 10.00 Years Bangalore 22 Sep, 2023

Roles & Responsibilities:

Provide accounting advisory support, including implementation assistance with Ind AS and other international GAAPs

Support a portf...
internal auditrisk advisory

relationship manager
Jobs Territory Hiring For Basic Home loan 1.00 to 3.00 Years Bangalore 22 Sep, 2023

The sales executives role is to evaluate and authorize approval of loan application for customers or for business. You will act as a liason between customers and our financial institution and you...
home loanshousing loanfield salesb2c salesmortgage loanshousing finance

Dot Net Angular with AWS
LTIMindtree Limited 5.00 to 9.00 Years Bangalore 22 Sep, 2023

Dear Candidates, We are hiring for the position of DotNet Angular with AWSat LTI Mindtree

Proven experience as a Senior Angular and Dot net develo...
html5karmajasmine frameworkrestful apisjavascriptsqlawsangular

Wintel Administrator
Quess Corp (Magna Infotech) 3.00 to 6.00 Years Bangalore 22 Sep, 2023

Wintel Admin Exp- 3 to 6years Location- Bangalore Np- 15days to Immediate Perform Security Health Check of Windows servers and other compliance. Perform timely Patch management as per the Sc...
incident managementraid configurationantivirus managementpatch managementdisk managementwintelproduction managementdnsadmin

Pyspark Developer
Orcapod Consulting Services Pvt Ltd 4.00 to 9.00 Years Bangalore 22 Sep, 2023

Job description Skill: Pyspark Experience: 6-9 yrs Location : Pan India Notice Period: 40 days Job Summary:

The developer must have sound knowledge in Apache Spark and Python p...
hadooppython

Python Developer
Quess Corp (Magna Infotech) 4.00 to 8.00 Years Bangalore 22 Sep, 2023

Python Developer Exp- 4 to 8years Location - HYD/BNG Np- 15days to Immediate We are seeking a Python Developer with expertise in SQL and PL/SQL. You will develop Python applications that inte...
gitpythonagilesql

Wintel Engineer
Quess Corp (Magna Infotech) 3.00 to 6.00 Years Bangalore 22 Sep, 2023

Wintel Exp- 3 to 6years Location- Bangalore Np- 15days to Immediate Job details: Windows Server Administrator / Level 2 support with 3 to 6 years experience Perform Security Health Check of ...
checkwindows server administrationraid configurationsecurityhealth

Urgent hiring for Mechanical Engineer Fresher
Karnataka Information Solution 0.00 to 4.00 Years Bangalore 22 Sep, 2023

Job Description Mechanical Engineer Educational Qualification: BE / B.Tech in Mechanical Job Types : Freshers, Experienced Skill : AutoCAD Salary : Rs.25,000/- to 50,000/- Mechanical Engin...
design engineeringmanufacturingproduction planning controlproduction engineering

Accounts payable in Bangalore
GETTJOBS Recruitment Firm Hiring For Accounts payable 3.00 to 5.00 Years Bangalore 22 Sep, 2023

Hi Greetings from Gettjobs Openings foraccounts payable JD for Payable- CAT 1. Category Invoice processing for all segments - Ensuring Compliance TDS/GST /MSME/LTDS etc and ...
audit managementratio analysisreconciliationaccounts payablegstauditcataccountstds working

Sponsorship Sales Media Industry Bangalore
Morpheus Human Consulting Pvt Ltd 3.00 to 8.00 Years Bangalore 22 Sep, 2023

Job Title: Sponsorship Sales Media Industry Bangalore The key responsibility of the role entails conceptualising and launching conference IPs in identified industry...
relationship managementbusiness developmentsales

Technical Lead Associate
Cognizant 2.00 to 0.00 Years Bangalore 22 Sep, 2023

Technical Lead Qualification: Bachelors in science , engineering or equivalent Responsibility: Requirement Understanding and Analys...
test datatest management tooltest cases

Urgent looking for Business Systems Analyst - SOX Compliance
Cisco Systems, Inc 3.00 to 7.00 Years Bangalore 22 Sep, 2023

What Youll Do You will be part of the Finance IT organization s SOX Control Execution Team that helps ensure Cisco has a strong internal control environment and is SOX Compliant. You will be wo...
it general controlsservice delivery managementoffice 365

We Have Reuire Application Developer
Accenture 1.00 to 6.00 Years Bangalore 22 Sep, 2023

About Accenture: Accenture is a global professional services company with leading capabilities in digital, cloud and security. Combining unmatched experience and specialized skill...
kaizenlean manufacturingsafetyinspectionmachiningms sql serverms sqlvisual studiobusiness processsystem installationsoftware engineeringsystem administrationprofessional servicessqlapi

Android Developer-Vishakhapatnam
Concept Consultant Service 3.00 to 8.00 Years Vishakhapatnam 14 Sep, 2023

Android Developer Responsibilities:

Must Have Skill - Android SDK, Androi...
c++javaandroid sdk

SALES CORDINATOR Visakhapatnam
Ayushman Enterprises 3.00 to 7.00 Years Vishakhapatnam 14 Sep, 2023

SALES CORDINATOR Exp: 3-7 Years Female Candidate Only Qualification: Graduate Salary: 2.4 lac to 3.20 lac Area to be Handling: Pan India Headquarter: Nehru Place We are lo...
managementinvoice processingsalesclientsarrange appointments

Regional Risk Manager
RAMA TECHNICAL CONSULTANTS 8.00 to 13.00 Years Vishakhapatnam 14 Sep, 2023

We are looking for a diligent risk manager to analyze and manage risk management issues for our organization. The Risk Managers responsibilities include conducting extensive research and assessme...
risk consultingconstruction riskrisk management

English Trainer
Foursis Technical Solution 2.00 to 4.00 Years Vadodara 14 Sep, 2023

Job functions area : Academic / Education / Teaching Location : Vadodara Experience : 2 - 4 years Skills : English, FLU...
englishcommunication skillsteachingtraininggrammareducationcommunicationGermanItalianFrenchCatalanSpanishLanguage ServicesDutchPortugueseTradosFaculty DevelopmentAcademia

Require for Field Service Engineer
Foursis Technical Solution 1.00 to 2.00 Years Vadodara 14 Sep, 2023

Job functions area : Service Engineer Location : Vadodara Experience : 1 - 2 years Skills : GOOD COMMUNICATION SKILL, S...
commissioningautomationtroubleshootingsitesalessite supervisionsupervisioncommunication

Head Engineering - Vadodara
Foursis Technical Solution 8.00 to 11.00 Years Vadodara 14 Sep, 2023

Job functions area : Engineering / Manufacturing / Production / Maintenance Location : Vadodara Experience : 8 - 11 years Skills ...
mechanicalmachinerycivilsafetysapquality checkmonitoringmaintenanceengineeringdocumentationKaizenRoot Cause AnalysisSix Sigma

Online Data Entry Operator
Max Data Entry Services LLP 0.00 to 2.00 Years Vadodara 14 Sep, 2023

We have urgent requirements of Online Data Entry Operator who is dedicated and serious about his work. We have various types of online and offline project works. Responsibilities: data entry operationms excelcomputer proficiencytyping speeddata entry

data analyst - Pune
MNR Solutions Pvt Ltd 0.00 to 2.00 Years Pune 14 Sep, 2023

Urgent Hiring-Data Entry operator Experience - 6 Month to 1 Years Budget - 2 LPA to 2.5 LPA Education - Graduate Of...
data entrydata entry operation

CONTRACT TO HIRE - PAM+ CyberArk consultant
Shell Info Technologies Pvt Ltd 3.00 to 8.00 Years Pune 14 Sep, 2023

Skill: CyberArk+PAM Positions: 10 Location:Hyderabad/ Bangalore/ Noida/Chennai/Gurgaon/Pune/ Kolkata Experience 3- 7 Years Work Mode: Hybrid Need to work from office Professional Qualification...
cyberarkiampam

SALES CORDINATOR Pune
Ayushman Enterprises 3.00 to 7.00 Years Pune 14 Sep, 2023

SALES CORDINATOR Exp: 3-7 Years Female Candidate Only Qualification: Graduate Salary: 2.4 lac to 3.20 lac Area to be Handling: Pan India Headquarter: Nehru Place We are lo...
managementinvoice processingsalesclientsarrange appointments

Service Desk Engineer
AVP HR SOLUTIONS PRIVATE LIMITED 3.00 to 4.00 Years Pune 14 Sep, 2023

We are hiring for Service Desk Engineer for pune location. Experience- 3+ years. Budget- 4 to 6 LPA. Global First and second level support for End-user Service Desk Install and Manage End-User...
desktop supportservicedeskengineer

Talent Acquisition Executive
Skywings Advisors Private Limited 1.00 to 6.00 Years Pune 14 Sep, 2023

1 Coordinate with hiring managers to identify staffing needs 2 Understanding the Requisitions/vacant positions shared by hiring managers. 3 Creating Talent Pipeline by Sourcing potential candid...
screeninghuman resource managementrecruitmentsourcingtalent acquisition

PREV
NEXT

documentation skill Job Openings

Duties and responsibilities

Job description Skill: Pyspark Experience: 6-9 yrs Location : Pan India Notice Period: 40 days Job Summary: The developer must have sound knowledge in Apache Spark and Python p... hadooppython

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Job description Skill: Pyspark Experience: 6-9 yrs Location : Pan India Notice Period: 40 days Job Summary:

The developer must have sound knowledge in Apache Spark and Python p...
hadooppython