Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
No of positions: 1 Qualification: Ph.D or M.Sc/M.Tech with minimum 10 to 15 years of experience in the production of probiotics and enzymes.Candidate should have thorough production knowledge of prob...
downstream processingenzymesupstreamprobioticsUpstream ProcessingTFFDepth FiltrationDiafiltrationViral ClearanceBioseparationsBioprocessingColumn PackingBiocatalysisDirected EvolutionEnzyme TechnologyUFDFJob Ref. : MKT-M-AF Qualifications : B.Tech. / B.Sc. / M.Sc. in Biotechnology / Biochemistry, preferably with MBA (marketing). Experience : Work experience in sales & marketing in a B2B environmen...
marketingsalesadvertisingbusiness developmentbrand managementcontinuous improvement facilitationhealthcare industryb2bhealthcarebiochemistrybiotechnologyContinuous Improvement CultureKaizensalesmarketingRooThe post involves maintaining of books of accounts & preparation of monthly financial statement / MIS report, preparation of variance report & financial analysis of these reports, local vendor payment...
bank reconciliationaccountingaccountsfinancetdssales taxincome taxservice taxcompany lawbalance sheetfinancial analysismisvattaxsalestallyexcisebalancesoftwarevendQualifications : B.Tech. / B.Sc. / M.Sc. in Food technology, preferably with MBA (Marketing). Experience : Work experience in sales & marketing in the food industry preferred. Fresher can also apply....
marketingsalescustomer relationsbusiness developmentadvertisingfood industryfood technologyfoodFood ManufacturingFood ProcessingFood TechnologyFrozen FoodMeatFood ScienceSQFsalesmarketingFlavThe post involves research & development of enzymes, fermentation processes and quality assurance. Candidates should be conversant with latest laboratory instruments. Required Candidate profile...
enzymesresearchmicrobiologyfermentationBiocatalysisDirected EvolutionEnzyme TechnologyProteasesCarbohydrateEnzyme ActivityCellulosic EthanolStrain DevelopmentMetabolic EngineeringQualitative ResearchScienceJob Profile: The post involves marketing and selling of enzymes in India. The profile covers management of product, marketing and sales of our enzymes products, business development, providing technic...
marketingsalesadvertisingbusiness developmentbrand managementtextile processingofferstextilesellingenzymesbusinessmanagementLaptopsRemote Desktoptechnical suppdistributtechnocommercialkstationsQualifications : B.Tech. / B.Sc. / M.Sc. in Food technology, preferably with MBA (Marketing). Experience : Work experience in sales & marketing in a B2B environment or experience in building new mark...
marketingsalesadvertisingbusiness developmentbrand managementcontinuous improvement facilitationfood industryfood technologyb2bfoodclaimsContinuous Improvement CultureKaizensalesmarketingRoot Cause AnalysQualifications : B.Tech. / B.Sc. / M.Sc. in Leather processing, preferably with MBA (Marketing). Experience : Work experience of 2-3 years in sales & marketing of leather auxiliaries and chemicals, p...
marketingsalesadvertisingbusiness developmentbrand managementcontinuous improvement facilitationleatherContinuous Improvement CultureKaizenRoot Cause AnalysisSix SigmaLean ManufacturingsalesmarketingThe post involves providing back office support and taking care of the entire co-ordination responsibilities of the marketing department. The profile covers managing correspondence, filing, documentat...
crminsurancemisassets recoverybackupms officeback officebudget preparationcommunication skillscareexcelemailfilingenglishsoftwarepressuremarketingpreparationback office suppoffice suppRoles and Responsibilities Candidate will be responsible for handling Enzyme Formulation and based at Corporate at Mumbai Office . 1. Ability to develop enzyme formulations for diff...
change controlmenu developmentregulatorygxpaseptic processingtrackwisecleaning validationfoodfibreformulationpulpdocumentationbiotechnologylyophilizationgmpdeviationsverification validationus title 21 cfr part 11 regulationcorrective preDescription: If you desire to be part of something special, to be part of a winning team, to be part of a fun team winning is fun. We are looking forward to a Lead Engineer - Mobile...
javacustomer relationslinuxautomationcomputer sciencepower managementdigital conversionbehavioral trainingmobile applicationsrtljirapaascloudagileazuretestsdesigndevopsJob Profile : The post involves marketing and selling of enzymes in India. The profile covers management of product, marketing and sales of our enzymes products, business development, providing techni...
marketingsalescustomer relationsbusiness developmentadvertisingtextile processingofferstextilesellingenzymesbusinessmanagementLaptopsRemote Desktoptechnical suppdistributtechnocommercialkstationsQualifications : B.Tech. / B.Sc. / M.Sc. in Food technology, preferably with MBA (Marketing). Experience : Work experience in sales & marketing in the food industry preferred. Fresher can also apply....
marketingsalescustomer relationsbusiness developmentadvertisingfood industryfood technologyfoodFood ManufacturingFood ProcessingFood TechnologyFrozen FoodMeatFood ScienceSQFsalesmarketingFlavJob Ref. : MKT-M-AF Qualifications : B.Tech. / B.Sc. / M.Sc. in Biotechnology / Biochemistry, preferably with MBA (marketing). Experience : Work experience in sales & marketing in a B2B environmen...
marketingsalesadvertisingbusiness developmentbrand managementcontinuous improvement facilitationhealthcare industryb2bhealthcarebiochemistrybiotechnologyContinuous Improvement CultureKaizensalesmarketingRooThe post involves maintaining of books of accounts & preparation of monthly financial statement / MIS report, preparation of variance report & financial analysis of these reports, local vendor payment...
bank reconciliationaccountingaccountsfinancetdssales taxincome taxservice taxcompany lawbalance sheetfinancial analysismisvattaxsalestallyexcisebalancesoftwarevendJob Profile: The post involves marketing and selling of enzymes in India. The profile covers management of product, marketing and sales of our enzymes products, business development, providing technic...
marketingsalesadvertisingbusiness developmentbrand managementtextile processingofferstextilesellingenzymesbusinessmanagementLaptopsRemote Desktoptechnical suppdistributtechnocommercialkstationsThe post involves providing back office support and taking care of the entire co-ordination responsibilities of the marketing department. The profile covers managing correspondence, filing, documentat...
crminsurancemisassets recoverybackupms officeback officebudget preparationcommunication skillscareexcelemailfilingenglishsoftwarepressuremarketingpreparationback office suppoffice suppQualifications : B.Tech. / B.Sc. / M.Sc. in Food technology, preferably with MBA (Marketing). Experience : Work experience in sales & marketing in a B2B environment or experience in building new mark...
marketingsalesadvertisingbusiness developmentbrand managementcontinuous improvement facilitationfood industryfood technologyb2bfoodclaimsContinuous Improvement CultureKaizensalesmarketingRoot Cause AnalysQualifications : B.Tech. / B.Sc. / M.Sc. in Leather processing, preferably with MBA (Marketing). Experience : Work experience of 2-3 years in sales & marketing of leather auxiliaries and chemicals, p...
marketingsalesadvertisingbusiness developmentbrand managementcontinuous improvement facilitationleatherContinuous Improvement CultureKaizenRoot Cause AnalysisSix SigmaLean ManufacturingsalesmarketingThe post involves research & development of enzymes, fermentation processes and quality assurance. Candidates should be conversant with latest laboratory instruments. Required Candidate profile...
enzymesresearchmicrobiologyfermentationBiocatalysisDirected EvolutionEnzyme TechnologyProteasesCarbohydrateEnzyme ActivityCellulosic EthanolStrain DevelopmentMetabolic EngineeringQualitative ResearchScienceDescription: If you desire to be part of something special, to be part of a winning team, to be part of a fun team winning is fun. We are looking forward to Senior Engineer based in ...
cssjavascriptjquerymysqlhtmlpower managementmobile applicationsrtljirapaascloudagileazuretestsdesignmobilebambooplanetoffersMolecular Biology kits commercial production. Preparation of SOP and its implementation, Kit manual writing, ISO documentation. Knowledge of automation systems buffer preparation, filling machines a...
sopapprovalsdocumentationvalidationresearchwritinglabelshplccalibrationpackagingfillingbiologyautomation systemsmolecular biologywritten communicationblow moldingMolecular Biology kits commercial production. Preparation of SOP and its implementation, Kit manual writing, ISO documentation. Knowledge of automation systems buffer preparation, filling machines and...
researchdocumentationblow moldingwritten communication
Qualification: M.Sc or B.Sc with minimum of 2 years of industrial experience
Candidates should have experience of working in industrial fermentation setup either in upstre...
sapinventory managementlogisticsdeliverymisdownstream processingbscenzymesupstreamwarehouseprobioticssupervisionfermentationUpstream ProcessingTFFDepth FiltrationDiafiltrationViral ClearanceBioseparationsUFDFNo of positions: 1 Qualification: Ph.D or M.Sc/M.Tech with minimum 10 to 15 years of experience in the production of probiotics and enzymes.Candidate should have thorough production knowledge of prob...
downstream processingenzymesupstreamprobioticsUpstream ProcessingTFFDepth FiltrationDiafiltrationViral ClearanceBioseparationsBioprocessingColumn PackingBiocatalysisDirected EvolutionEnzyme TechnologyUFDFThe post involves providing back office support and taking care of the entire co-ordination responsibilities of the marketing department. The profile covers managing correspondence, filing, documentat...
crminsurancemisassets recoverybackupms officeback officebudget preparationcommunication skillscareexcelemailfilingenglishsoftwarepressuremarketingpreparationback office suppoffice suppQualifications : B.Tech. / B.Sc. / M.Sc. in Food technology, preferably with MBA (Marketing). Experience : Work experience in sales & marketing in a B2B environment or experience in building new mark...
marketingsalesadvertisingbusiness developmentbrand managementcontinuous improvement facilitationfood industryfood technologyb2bfoodclaimsContinuous Improvement CultureKaizensalesmarketingRoot Cause AnalysQualifications : B.Tech. / B.Sc. / M.Sc. in Food technology, preferably with MBA (Marketing). Experience : Work experience in sales & marketing in the food industry preferred. Fresher can also apply....
marketingsalescustomer relationsbusiness developmentadvertisingfood industryfood technologyfoodFood ManufacturingFood ProcessingFood TechnologyFrozen FoodMeatFood ScienceSQFsalesmarketingFlavThe post involves research & development of enzymes, fermentation processes and quality assurance. Candidates should be conversant with latest laboratory instruments. Required Candidate profile...
enzymesresearchmicrobiologyfermentationBiocatalysisDirected EvolutionEnzyme TechnologyProteasesCarbohydrateEnzyme ActivityCellulosic EthanolStrain DevelopmentMetabolic EngineeringQualitative ResearchScienceQualifications : B.Tech. / B.Sc. / M.Sc. in Leather processing, preferably with MBA (Marketing). Experience : Work experience of 2-3 years in sales & marketing of leather auxiliaries and chemicals, p...
marketingsalesadvertisingbusiness developmentbrand managementcontinuous improvement facilitationleatherContinuous Improvement CultureKaizenRoot Cause AnalysisSix SigmaLean ManufacturingsalesmarketingJob Ref. : MKT-M-AF Qualifications : B.Tech. / B.Sc. / M.Sc. in Biotechnology / Biochemistry, preferably with MBA (marketing). Experience : Work experience in sales & marketing in a B2B environmen...
marketingsalesadvertisingbusiness developmentbrand managementcontinuous improvement facilitationhealthcare industryb2bhealthcarebiochemistrybiotechnologyContinuous Improvement CultureKaizensalesmarketingRooThe post involves maintaining of books of accounts & preparation of monthly financial statement / MIS report, preparation of variance report & financial analysis of these reports, local vendor payment...
bank reconciliationaccountingaccountsfinancetdssales taxincome taxservice taxcompany lawbalance sheetfinancial analysismisvattaxsalestallyexcisebalancesoftwarevendJob Profile: The post involves marketing and selling of enzymes in India. The profile covers management of product, marketing and sales of our enzymes products, business development, providing technic...
marketingsalesadvertisingbusiness developmentbrand managementtextile processingofferstextilesellingenzymesbusinessmanagementLaptopsRemote Desktoptechnical suppdistributtechnocommercialkstationsRoles and Responsibilities The candidate will be based at the Corporate office of the Pharma Company in Mumbai and supporting the various projects of the Group Companies. You will b...
fibremarket opportunitiesetpdetailed project reportcorporate affairstamilpharmaagencycivilexternal agenciesregulatory affairsgovernment affairsproject developmentbrandprogress monitoringdesignbranding identity marketingcsr
Qualification: M.Sc or B.Sc with minimum of 2 years of industrial experience
Candidates should have experience of working in industrial fermentation setup either in upstre...
sapinventory managementlogisticsdeliverymisdownstream processingbscenzymesupstreamwarehouseprobioticssupervisionfermentationUpstream ProcessingTFFDepth FiltrationDiafiltrationViral ClearanceBioseparationsUFDFNo of positions: 1 Qualification: Ph.D or M.Sc/M.Tech with minimum 10 to 15 years of experience in the production of probiotics and enzymes.Candidate should have thorough production knowledge of prob...
downstream processingenzymesupstreamprobioticsUpstream ProcessingTFFDepth FiltrationDiafiltrationViral ClearanceBioseparationsBioprocessingColumn PackingBiocatalysisDirected EvolutionEnzyme TechnologyUFDF* Technical Manager Animal NutritionRole: The successful candidate will work within the highly motivated South Asia Sales Team to grow and retain business with the poultry industry. ...
javaagileproject managementdeliverycustomer relationssouth asiafield trialsapplication supporttechnology transfertroubleshooting skillssalesdesignJob Profile : The post involves marketing and selling of enzymes in India. The profile covers management of product, marketing and sales of our enzymes products, business development, providing techni...
marketingsalescustomer relationsbusiness developmentadvertisingtextile processingofferstextilesellingenzymesbusinessmanagementLaptopsRemote Desktoptechnical suppdistributtechnocommercialkstationsQualifications : B.Tech. / B.Sc. / M.Sc. in Leather processing, preferably with MBA (Marketing). Experience : Work experience of 2-3 years in sales & marketing of leather auxiliaries and chemicals, p...
marketingsalesadvertisingbusiness developmentbrand managementcontinuous improvement facilitationleatherContinuous Improvement CultureKaizenRoot Cause AnalysisSix SigmaLean ManufacturingsalesmarketingThe post involves research & development of enzymes, fermentation processes and quality assurance. Candidates should be conversant with latest laboratory instruments. Required Candidate profile...
enzymesresearchmicrobiologyfermentationBiocatalysisDirected EvolutionEnzyme TechnologyProteasesCarbohydrateEnzyme ActivityCellulosic EthanolStrain DevelopmentMetabolic EngineeringQualitative ResearchScienceQualifications : B.Tech. / B.Sc. / M.Sc. in Food technology, preferably with MBA (Marketing). Experience : Work experience in sales & marketing in the food industry preferred. Fresher can also apply....
marketingsalescustomer relationsbusiness developmentadvertisingfood industryfood technologyfoodFood ManufacturingFood ProcessingFood TechnologyFrozen FoodMeatFood ScienceSQFsalesmarketingFlavJob Ref. : MKT-M-AF Qualifications : B.Tech. / B.Sc. / M.Sc. in Biotechnology / Biochemistry, preferably with MBA (marketing). Experience : Work experience in sales & marketing in a B2B environmen...
marketingsalesadvertisingbusiness developmentbrand managementcontinuous improvement facilitationhealthcare industryb2bhealthcarebiochemistrybiotechnologyContinuous Improvement CultureKaizensalesmarketingRooQualifications : B.Tech. / B.Sc. / M.Sc. in Leather processing, preferably with MBA (Marketing). Experience : Work experience of 1-2 years in sales & marketing of leather auxiliaries and chemicals pr...
marketingsalescustomer relationsbusiness developmentadvertisingleatherCold CallingSales ProcessDirect SalesSales OperationsSales PresentationsCustomer RetentionsalesmarketingBusinesstoBusinessOutsiJob Profile: The post involves marketing and selling of enzymes in India. The profile covers management of product, marketing and sales of our enzymes products, business development, providing technic...
marketingsalesadvertisingbusiness developmentbrand managementtextile processingofferstextilesellingenzymesbusinessmanagementLaptopsRemote Desktoptechnical suppdistributtechnocommercialkstationsQualifications : B.Tech. / B.Sc. / M.Sc. in Food technology, preferably with MBA (Marketing). Experience : Work experience in sales & marketing in a B2B environment or experience in building new mark...
marketingsalesadvertisingbusiness developmentbrand managementcontinuous improvement facilitationfood industryfood technologyb2bfoodclaimsContinuous Improvement CultureKaizensalesmarketingRoot Cause AnalysThe post involves maintaining of books of accounts & preparation of monthly financial statement / MIS report, preparation of variance report & financial analysis of these reports, local vendor payment...
bank reconciliationaccountingaccountsfinancetdssales taxincome taxservice taxcompany lawbalance sheetfinancial analysismisvattaxsalestallyexcisebalancesoftwarevendThe post involves providing back office support and taking care of the entire co-ordination responsibilities of the marketing department. The profile covers managing correspondence, filing, documentat...
crminsurancemisassets recoverybackupms officeback officebudget preparationcommunication skillscareexcelemailfilingenglishsoftwarepressuremarketingpreparationback office suppoffice suppMolecular Biology kits commercial production. Preparation of SOP and its implementation, Kit manual writing, ISO documentation. Knowledge of automation systems buffer preparation, filling machines and...
researchdocumentationblow moldingwritten communication*Position Purpose & Summary The purpose of this position is to provide technology support (subject matter expert) in the areas of nutrition, enzymes and mycotoxins to poultry species team (internal) a...
riscproduct developmentbusiness developmentdna analysisqpcrcommunication skillsmarket trendsfoodsalespoultryenzymestrainingseasonalnutritionportfolioadditivesMarket Research Analyst: Qualification: MBA with special interest in biomedical market and supply chain. Preferable a bachelor degree in Biotechnology / Molecular biology/ Chemistry / Biochemistry/ s...
secondary researchresearchsalesmarketingmarket research© 2019 Hireejobs All Rights Reserved