expert in ecommerce global selling jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

expert in ecommerce global selling Job Openings

Showing 25251 - 25300 of 41090 Jobs

Mgr-Housekeeping

Marriott International, Inc 2.00 to 6.00 Years Jaipur,Other Rajasthan 12 Nov, 2024

Hiring For Business Manager

Niyukti Management Consultants Hiring For Niyukti Management Consultants 4.00 to 9.00 Years Jaipur,Delhi, Bhubaneswar, Varanasi, Kanpur, Lucknow, Gurugram, Kolkata, Ludhiana, Agra 12 Nov, 2024

Post

Location

Salary

agency development manager

agency manager

Sr Business Manager

Niyukti Management Consultants Hiring For Insurance 6.00 to 11.00 Years Jaipur,Noida, Delhi, Varanasi, Ghaziabad, Kanpur, Lucknow, Gurugram, Faridabad, Chandigarh 12 Nov, 2024

Urgent | Apply JOB For Sr Business Manager Elite Vertical Top 5 Insurance salary up to 7 Lac

Insurance,

Location DelhiGurugramNoidaChandigarhFaridabadG...
insurance agency managementsalesinsurance salesbusiness managerunit managersales manager

Manufacturing Head
KINAL GLOBAL CARE PRIVATE LIMITED 21.00 to 25.00 Years Jaipur,Gambia, Bhutan, Vadodara, Meerut, Qatar, Patna, South Africa, Morocco, Cuddalore, Kalyan, Mya 12 Nov, 2024

Data collection andanalysis: Maintain database with failure details, site feedback, observation onsite and actual findings, modules status, turnaround time (TAT) for each andevery module...
material managementdata collectionautomationlogistics managementproduction planning controlmachine toolsfailure analysisproduct engineeringdynamic random-access memory

Construction Head
KINAL GLOBAL CARE PRIVATE LIMITED 21.00 to 25.00 Years Jaipur,Vadodara, Oman, Meerut, Puerto Rico, Patna, Cuddalore, Kalyan, Uganda, Tanzania, Philippines, 12 Nov, 2024

Prepare project plans and carry them out. Create feasibility studies by analyzing engineering design, conducting environmental impact studies, and assembling data. * Determine project costs by c...
construction engineeringsoil stabilizationconstruction equipmentbuilding constructionconstruction supervisionconstruction chemicalsroadworksproject engineeringengineering services

Territory Manager
KINAL GLOBAL CARE PRIVATE LIMITED 21.00 to 25.00 Years Jaipur,Vadodara, Meerut, Patna, Zimbabwe, Romania, Saudi Arabia, Cuddalore, Rwanda, Kalyan, Uganda, 12 Nov, 2024

You will be responsible for the promotion of the new product. You will be executing the Product Management Team s marketing strategy, analysing market trends, consulting with doctors on ...
analytical skillsmarketing strategymonitoring toolsterritory managementproduct planningproduct managementauditing standardsfinancial forecastingcommunication skills

Field Sales Manager
KINAL GLOBAL CARE PRIVATE LIMITED 21.00 to 25.00 Years Jaipur,Vadodara, Puerto Rico, Meerut, Patna, Romania, Saudi Arabia, Cuddalore, Kalyan, Venezuela, Ta 12 Nov, 2024

Conducting Sales Pitch, Product Demos & handling questions and objections of prospective customers. Generate leads through various channels through cold callings, networking & referrals. Connec...
field sales managementbusiness-to-businessproduct salesdirect salesexecutive relationshipssales executive activitiesfield workenterprise accountscomplex sales

Territory Manager
KINAL GLOBAL CARE PRIVATE LIMITED 21.00 to 25.00 Years Jaipur,Vadodara, Meerut, Patna, Zimbabwe, Romania, Saudi Arabia, Cuddalore, Rwanda, Kalyan, Uganda, 12 Nov, 2024

You will be responsible for the promotion of the new product. You will be executing the Product Management Team s marketing strategy, analysing market trends, consulting with doctors on ...
analytical skillsmarketing strategymonitoring toolsterritory managementproduct planningproduct managementauditing standardsfinancial forecastingcommunication skills

Field Sales Manager
KINAL GLOBAL CARE PRIVATE LIMITED 21.00 to 25.00 Years Jaipur,Vadodara, Puerto Rico, Meerut, Patna, Romania, Saudi Arabia, Cuddalore, Kalyan, Venezuela, Ta 12 Nov, 2024

Conducting Sales Pitch, Product Demos & handling questions and objections of prospective customers. Generate leads through various channels through cold callings, networking & referrals. Connec...
field sales managementbusiness-to-businessproduct salesdirect salesexecutive relationshipssales executive activitiesfield workenterprise accountscomplex sales

Implementation Manager
KINAL GLOBAL CARE PRIVATE LIMITED 11.00 to 21.00 Years Jaipur,Singapore, Vadodara, Puerto Rico, Meerut, Patna, Saudi Arabia, Cuddalore, Senegal, Kalyan, Ug 12 Nov, 2024

ob responsibilities: Design all job requirements and specifications and manage all communication with implementation analysts. Resolve all issues and develop all programs according to client ...
project managementimplementation planningimplementation experiencebusiness developmentsoftware installationorder managementstatistical modelingdata analysisproduct training

Urgent Opening for Relationship Manager - SME - DST
Gens Management Consultant Private Limited 4.00 to 8.00 Years Jaipur,Lucknow 12 Nov, 2024

Role - Relationship Manager - SME - DST Location - Jaipur/ Lucknow Experience - 4 Yrs in Prime LAP (20Cr. To 100 Cr.) or lesser if candidate is willing to work in large portfolio. Requirements - ...
mortgagehome loans

Assistant Registrar
TEAMWORK CABLES PRIVATE LIMITED 4.00 to 7.00 Years Nagaon,Golaghat, Tarapur, Canada, Patna, Russia, Bangalore, Mohali, Sri Lanka, Machilipatnam, Buxar, 12 Nov, 2024

Provides essential leadership and supervisory support for the Registrars Office overseeing the areas of academic room scheduling, certification of military education benefits, and NCAA certifica...
communicationproblemsolvingdetail

Senior Executive
TEAMWORK CABLES PRIVATE LIMITED 3.00 to 8.00 Years Kamrup,Sonitpur, Barpeta, Purnia, Vizianagaram, Mohali, Hyderabad, Chittoor, Gopalganj, Lakhisarai 12 Nov, 2024

Operational Responsibilities

Bank has multiple partners in General Insurance business and our focus is retaining leadership positions and having maximum share in terms of busine...
change managementemotional intelligence

Electrical Engineer
AES INDUSTRIAL PRIVATE LIMITED 6.00 to 11.00 Years Other Assam,China, Bangladesh, Other Bihar, Qatar, Other Goa, Other Arunachal Pradesh, South Korea, 12 Nov, 2024

We are looking for an electrical engineer who will help us advance our electrical products, systems, and applications. On a daily basis, youll carry out various engineering tasks, such as perfor...
physicsmathematicsskills.criticalthinking.

Agency Development Manager
RELIANCE NIPPON LIFE INSURANCE COMPANY LIMITED 1.00 to 6.00 Years Jorhat,Bardhaman, Siliguri, Agartala 12 Nov, 2024

- We are looking for young, high-energy individuals with a passion for sales and for achieving aspirational targets. This is an insurance sales role for our Agency business. CTC...
agency salesfield salessaleslife insurancedirect sales

Data Analyst , Senior Data Analyst , Data Analyst - Tech Lead
AppSoft Solutions 0.00 to 4.00 Years Hyderabad,Bangalore, Chennai, Noida, Gurugram, Kolkata, Pune, Mumbai City, Delhi 12 Nov, 2024

Data Analyst / Senior Data Analyst / Data Analyst - Tech Lead Very Urgent Requirement If Your Profile Matches The Above Requirement And If Youre Interested In The Above Openi...
data analyst

SR.AWS Data Engineer
MAVINSYS GLOBAL PRIVATE LIMITED Hiring For Capgemini 6.00 to 8.00 Years Hyderabad 12 Nov, 2024

Hello,

Apache PySpark-Four to Six Years,

Data Engineer-Four to Six Years

pyspark,SQL,AWS

5 to 8 years

Hyderabad
dataawssqlapacheengineerpyspark

Sales Executive
Avani Consulting 1.00 to 6.00 Years Hyderabad,Bangalore, Chennai, Vijayawada, Tiruchirappalli, Vishakhapatnam, Pune, Mumbai City, Coimba 12 Nov, 2024

Job Title: Sales Executive - Demat Account Acquisition Hiring Consultancy: Avani Consultancy Location:Erode,Chennai,Coimbatore,Madurai,Mumbai,Hy...
demat accountsfinancial products

Equity Dealer
Avani Consulting 1.00 to 6.00 Years Hyderabad,Madurai, Bangalore, Chennai, Mumbai City 12 Nov, 2024

Job Title: Relationship Manager Hiring Consultancy: Avani Consultancy Location:Chennai,Madurai,Hyderabad,Bangalore,Mumbai,Pune Experienc...
equity tradingequity sales

Branch Manager - Overseas Education
5 LANDS EDUCATION CONSULTANCY Hiring For Client 5.00 to 10.00 Years Hyderabad 12 Nov, 2024

1. Branch Manager who can counsel students on USA, UK, Canada and Australia Overseas Education Counselling 2. Who Can Resolve Queries and Help Indian Students Apply to Universities Abroad. 3. Ad...
study abroad programsoverseas educationsalesvisa documentationbranch operationsvisa processingcounsellingoperations management

Equity Derivative Dealer
Apex Services Hiring For Apex Services 1.00 to 6.00 Years Hyderabad,Bangalore, Chennai 12 Nov, 2024

Greetings from APEX SERVICES Role-EquityDealer/ PCG dealer CTC- upto-6 LPA incentive oth...
stock marketclient acquisitionstock brokingonline tradingbrokingsecuritiesequity trading

Implementation Officer
KINAL GLOBAL CARE PRIVATE LIMITED 0.00 to 4.00 Years Hyderabad,Latur, Chakan, Singapore, Puerto Rico, Saudi Arabia, Panaji, Senegal, Bhubaneswar, Uganda, 12 Nov, 2024

ob responsibilities: Design all job requirements and specifications and manage all communication with implementation analysts. Resolve all issues and develop all programs according to client ...
project managementimplementation planningimplementation experiencebusiness developmentsoftware installationorder managementstatistical modelingdata analysisproduct training

Urgent Hiring For Linux or windows administrators with experience on puppet auto
ITSOURCE GLOBAL SERVICES PRIVATE LIMITED 8.00 to 12.00 Years Hyderabad,Bangalore, Chennai, Pune, Mumbai City 12 Nov, 2024

Dear Candidate, Urgent Vacancy For the below skills Linux, Windows administrators, Puppet and github Locations Pan india Ctc upto 42 LPA Need 30 days joiners Experience 8 to 12 yrs If inte...
linuxgithubpuppet

Senior Associate
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 9.00 Years Hyderabad,Bangalore, Chennai, Noida, Gurugram, Pune, Mumbai City, Delhi 12 Nov, 2024

Job description

The Product Development (PD) team within Morgan Stanley Fund Services (MSFS) is the change & transformation think tank that works with the fund services business...
financial reportingtest casesoperationsbusiness strategydata structuresvisioautomationcoding

Urgent Hiring for International Voice process WFO_HYD
Sahasya Global Solutions Private Limited 3.00 to 8.00 Years Hyderabad 12 Nov, 2024

Hiring for International Voice process Min 3 Year of experience into international voice process Qualification: 102/ 103/Graduates /PG Location: Hyderabad Package : Up to 7.5lpa Roles & resp...
customer serviceinternational voice processcustomer supportinternational bpo

Account Manager/ Customer Success manager
Axycube Solutions Pvt Ltd 3.00 to 8.00 Years Hyderabad,Bangalore, Chennai, Kolkata, Mumbai City 12 Nov, 2024

1. Position - Account Manager/ Customer Success manager 2. Location- Bangalore/ Mumbai/ Hyderabad/Kolkata. 3. Experience- 4- 8 years of relevant experience in selling Solutions/Services pertain...
it hardware salesamc

Medical Coder(Div 09)
Starworth Global Solutions 1.00 to 6.00 Years Hyderabad,Bangalore, Chennai 12 Nov, 2024

We are Hiring Medical Coders (IPDRG,Denial,Hcc.E&M IP/OP,ED) Exp 1 yrs in Medical coding Certified Or Non Certified (Any Certification ) location Chennai, Bangalore If Intrested surgeryhcc codingradiologymedical codinggeneral surgerye/m coding

Investment Counseller
AV Global Advisory Services 10.00 to 15.00 Years Hyderabad,Mumbai City 12 Nov, 2024

Hiring for Investment Counselor Experience- Minimum 10-15 years of relevant experience in Wealth Management, investment advisory in banks/ NBFC firms is must. Should be well versed in financial...
wealthinvestment advisoryinvestment counselor

Fashion Designer
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 5.00 to 10.00 Years Hyderabad,Bangalore, Noida, Chennai, Gurugram, Pune, Mumbai City, Delhi 12 Nov, 2024

Key Responsibilities:

Trend Research & Concept Development: Stay updated with global fashion trends, colors, and materials to inspire innovative collections. costume designingphotoshop

Ar Caller & Sr Ar Caller
Starworth Global Solutions 1.00 to 4.00 Years Hyderabad,Bangalore, Chennai 12 Nov, 2024

EXECUTIVE AR / SR EXECUTIVE AR Note: Freshers please ignore this Experience - 1 to 5 years in VOICE PROCESS *Physician billing, Hospital billing, credentials and appeals **voice process only* ...
ar callingdenial managementar calling medical billingphysician billingsr ar executive

Front Office Associate
M/S LANDCRAFT RECREATIONS PRIVATE LIMITED 5.00 to 8.00 Years Hyderabad,Armenia, China, Congo, Qatar, Patna, Saudi Arabia, Zimbabwe, Ahmedabad, Bangalore, Kuwait, 12 Nov, 2024

Job description A Front Office Associate assists in daily Front Office operations and works with customers and Guests to serve their needs and provide an excellent customer service experience. W...
receptioncustomer servicehospitalityguest serviceguest relationsrooms divisioncustomer relationsfront officeguest handling

Direct Channel Sales
RELIANCE NIPPON LIFE INSURANCE COMPANY LIMITED 0.00 to 4.00 Years Hyderabad,Bangalore, Guntur, Rajahmundry, Chennai, Vijayawada, Vishakhapatnam, Amalapuram, Kakinada, 12 Nov, 2024

Dear Candidate, Indias Best Life Insurance company is offering you senior sales roles with high salary package Best benefits package with on-role employment on company pay-rolls in your preferr...
agency salesvehiclemotor insurancedirect channel salesinsuranceinsurance saleswheeler

Front Office Associate
M/S LANDCRAFT RECREATIONS PRIVATE LIMITED 5.00 to 8.00 Years Delhi,Armenia, China, Congo, Qatar, Patna, Saudi Arabia, Zimbabwe, Ahmedabad, Bangalore, Kuwait, Ind 12 Nov, 2024

Job description A Front Office Associate assists in daily Front Office operations and works with customers and Guests to serve their needs and provide an excellent customer service experience. W...
receptioncustomer servicehospitalityguest serviceguest relationsrooms divisioncustomer relationsfront officeguest handling

Implementation Executive
KINAL GLOBAL CARE PRIVATE LIMITED 5.00 to 10.00 Years Gurugram,Faridabad, Singapore, Surat, Puerto Rico, Saudi Arabia, Senegal, Uganda, Peru, Rajahmundry, 12 Nov, 2024

ob responsibilities: Design all job requirements and specifications and manage all communication with implementation analysts. Resolve all issues and develop all programs according to client ...
project managementimplementation planningimplementation experiencebusiness developmentsoftware installationorder managementstatistical modelingdata analysisproduct training

Sales Executive
Avani Consulting 1.00 to 6.00 Years Erode,Tiruchirappalli, Coimbatore, Chennai, Bangalore, Vijayawada, Hyderabad, Vishakhapatnam, Pune, 12 Nov, 2024

Job Title: Sales Executive - Demat Account Acquisition Hiring Consultancy: Avani Consultancy Location:Erode,Chennai,Coimbatore,Madurai,Mumbai,Hy...
demat accountsfinancial products

Sales Executive
Avani Consulting 1.00 to 6.00 Years Erode,Tiruchirappalli, Coimbatore, Chennai, Bangalore, Vijayawada, Hyderabad, Vishakhapatnam, Pune, 12 Nov, 2024

Job Title: Sales Executive - Demat Account Acquisition Hiring Consultancy: Avani Consultancy Location:Erode,Chennai,Coimbatore,Madurai,Mumbai,Hy...
demat accountsfinancial products

Direct Channel Sales
RELIANCE NIPPON LIFE INSURANCE COMPANY LIMITED 0.00 to 4.00 Years Hyderabad,Bangalore, Guntur, Rajahmundry, Chennai, Vijayawada, Vishakhapatnam, Amalapuram, Kakinada, 12 Nov, 2024

Dear Candidate, Indias Best Life Insurance company is offering you senior sales roles with high salary package Best benefits package with on-role employment on company pay-rolls in your preferr...
agency salesvehiclemotor insurancedirect channel salesinsuranceinsurance saleswheeler

Fashion Designer
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 5.00 to 10.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Pune, Mumbai City 12 Nov, 2024

Key Responsibilities:

Trend Research & Concept Development: Stay updated with global fashion trends, colors, and materials to inspire innovative collections. costume designingphotoshop

Front Office Associate
M/S LANDCRAFT RECREATIONS PRIVATE LIMITED 5.00 to 8.00 Years Delhi,Armenia, China, Congo, Qatar, Patna, Saudi Arabia, Zimbabwe, Ahmedabad, Bangalore, Kuwait, Ind 12 Nov, 2024

Job description A Front Office Associate assists in daily Front Office operations and works with customers and Guests to serve their needs and provide an excellent customer service experience. W...
receptioncustomer servicehospitalityguest serviceguest relationsrooms divisioncustomer relationsfront officeguest handling

Implementation Executive
KINAL GLOBAL CARE PRIVATE LIMITED 5.00 to 10.00 Years Gurugram,Faridabad, Singapore, Surat, Puerto Rico, Saudi Arabia, Senegal, Uganda, Peru, Rajahmundry, 12 Nov, 2024

ob responsibilities: Design all job requirements and specifications and manage all communication with implementation analysts. Resolve all issues and develop all programs according to client ...
project managementimplementation planningimplementation experiencebusiness developmentsoftware installationorder managementstatistical modelingdata analysisproduct training

Sales Executive
Avani Consulting 1.00 to 6.00 Years Erode,Tiruchirappalli, Coimbatore, Chennai, Bangalore, Vijayawada, Hyderabad, Vishakhapatnam, Pune, 12 Nov, 2024

Job Title: Sales Executive - Demat Account Acquisition Hiring Consultancy: Avani Consultancy Location:Erode,Chennai,Coimbatore,Madurai,Mumbai,Hy...
demat accountsfinancial products

German Language Expert
SALARY HIKERS Hiring For MNC 1.00 to 6.00 Years Gurugram 12 Nov, 2024

Job Overview:We are actively seeking enthusiastic and dedicated individuals to join our team as German Language Experts. The successful candidates will be responsible for handlin...
german teachinggerman to englishgerman literaturegerman languageenglishenglish to germangoethe

Sales Associate
Orbit Global HR Consultants Hiring For sales Associate 0.00 to 4.00 Years Gurugram 12 Nov, 2024

Hiring For Associate Sales Consultant Location :- Gurgaon, Haryana Job Responsibilities :- 1. Assisting customers in the sale of a range of financial products on the phone. ...
graduatesalestelesalesbpooutbound salesupsellingcold callingnight shifttelecalling

Data Scientist
MAVINSYS GLOBAL PRIVATE LIMITED 6.00 to 10.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 12 Nov, 2024

Statistical Analysis & Data Modeling: Use advanced statistical techniques such as forecasting, time series analysis, trend an...
data modelingforecasting skills

Direct channel
Skywings Advisors Private Limited 1.00 to 6.00 Years Ghaziabad,Rewari, Gorakhpur, Muzaffarpur, Cuttack, Kota, Jamshedpur, Jalandhar, Sambalpur, Ajmer 12 Nov, 2024

Dear candidates We are hiring for leading life insurance company Profiles:- Financial Planning Manager Job Details : Roles and Responsibilities

Achieving s...
direct channel salesinsurance saleslife insurancebfsi salesinsurancebanking salesagency channelcross sellingbanking products

Travel Consultant
VIZ TRAVELS PRIVATE LIMITED 1.00 to 6.00 Years Noida 12 Nov, 2024

Job Title: Travel Consultant Viz Travels Private Limited Working Days: Monday to Saturday Working Hours: 10:00 AM to 7:00 PM convincing peopletravel planningtravel arrangementscommunication skillstravel salesholiday packages

Implementation Executive
KINAL GLOBAL CARE PRIVATE LIMITED 5.00 to 10.00 Years Gurugram,Faridabad, Singapore, Surat, Puerto Rico, Saudi Arabia, Senegal, Uganda, Peru, Rajahmundry, 12 Nov, 2024

ob responsibilities: Design all job requirements and specifications and manage all communication with implementation analysts. Resolve all issues and develop all programs according to client ...
project managementimplementation planningimplementation experiencebusiness developmentsoftware installationorder managementstatistical modelingdata analysisproduct training

Salesforce Vlocity- Lead, Architect(PAN INDIA)
Wroots Global Private Limited 7.00 to 12.00 Years Gurugram,Delhi, Bangalore 12 Nov, 2024

Minimum one full cycle project implementations in Vlocity required Strong experience in Vlocity implementation in Telecom or Healthcare domain Lightning web comonen...
salesforcevlocity

Process Expert & Functional Expert
VALCUS PRIVATE LIMITED 3.00 to 7.00 Years Gurugram,Noida 12 Nov, 2024

Position:Process Expert & Functional Expert Experience: 3-7 years of insurance Employment Type: Full-Time, Permanent casualtydocumentationinsuranceexcel

Sr. Merchandiser
PINNACLE IMPEX PVT LTD 10.00 to 14.00 Years Erode,Other Tamil Nadu 12 Nov, 2024

Supports the costing process during a season including ensuring all cost sheets are complete and submitted in a timely fashion Ensures SMS are accurate, complete and shipped timely Works collabo...
MerchandisingQualityCostingProductionMarketingProduct DevelopmentQuality ControlMaterials SupplyEcommerce

PREV
NEXT

expert in ecommerce global selling Job Openings

Job description The Product Development (PD) team within Morgan Stanley Fund Services (MSFS) is the change & transformation think tank that works with the fund services business... financial reportingtest casesoperationsbusiness strategydata structuresvisioautomationcoding

Key Responsibilities:

Key Responsibilities:

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Job description

The Product Development (PD) team within Morgan Stanley Fund Services (MSFS) is the change & transformation think tank that works with the fund services business...
financial reportingtest casesoperationsbusiness strategydata structuresvisioautomationcoding