global technology jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

global technology Job Openings

Showing 26001 - 26050 of 43246 Jobs

Implementation Manager

KINAL GLOBAL CARE PRIVATE LIMITED 11.00 to 21.00 Years Jaipur,Singapore, Vadodara, Puerto Rico, Meerut, Patna, Saudi Arabia, Cuddalore, Senegal, Kalyan, Ug 12 Nov, 2024

project management

implementation planning

implementation experience

business development

software installation

Electrical Engineer

AES INDUSTRIAL PRIVATE LIMITED 6.00 to 11.00 Years Other Assam,China, Bangladesh, Other Bihar, Qatar, Other Goa, Other Arunachal Pradesh, South Korea, 12 Nov, 2024

Supply Chain Manager

TERCELHERBS PRIVATE LIMITED 1.00 to 6.00 Years Goalpara,Darrang, Bangalore, Chennai, Other Chattisgarh, Arwal, Buxar, Hyderabad, Port Blair 12 Nov, 2024

Urgent recruitment from Asia at Morrisons Supermarket United Kingdom, that i believe it will suites your profile as a manager, We are looking for a results driven retail Logistic Manager...
transportation managementthird-party logisticslogistics planninglogistics coordinationsupply chain managementlogistics

Data Analyst , Senior Data Analyst , Data Analyst - Tech Lead
AppSoft Solutions 0.00 to 4.00 Years Hyderabad,Bangalore, Chennai, Noida, Gurugram, Kolkata, Pune, Mumbai City, Delhi 12 Nov, 2024

Data Analyst / Senior Data Analyst / Data Analyst - Tech Lead Very Urgent Requirement If Your Profile Matches The Above Requirement And If Youre Interested In The Above Openi...
data analyst

HR Manager - Compensation and Benefits
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 9.00 Years Hyderabad,Bangalore, Chennai, Noida, Gurugram, Pune, Mumbai City, Delhi 12 Nov, 2024

Responsibilities

Design compensation and benefits packages

Implement performance review procedures (e.g. quarterly/annual and 360 evaluations)

Develop fair HR po...
executioncommunication skillsstrategyadvisingcreation

SR.AWS Data Engineer
MAVINSYS GLOBAL PRIVATE LIMITED Hiring For Capgemini 6.00 to 8.00 Years Hyderabad 12 Nov, 2024

Hello,

Apache PySpark-Four to Six Years,

Data Engineer-Four to Six Years

pyspark,SQL,AWS

5 to 8 years

Hyderabad
dataawssqlapacheengineerpyspark

Urgent Hiring Electrical Engineer Fresher
Classic Enterprises Fresher Hyderabad,Bhubaneswar, Bangalore, Kanpur, Lucknow, Pune, Mumbai City, Bhopal, Patna, Guwahati 12 Nov, 2024

Dear Candidate, We Are Hiring for Electrical Engineer. Freshercan also apply for the vacancy. Production Engineer Responsibilitys Production engineers work in the sphere of manufacturing, over...
quality analysismaintenancemanufacturingassurancequality engineeringquality controlrf engineering

Technical Program Manager - Contract for 6 to 12 Months
LAGRAN SOFTWARE SOLUTIONS PRIVATE LIMITED 12.00 to 22.00 Years Hyderabad,Gurugram 12 Nov, 2024

Job Position (Title) Technical Program Manager

Experience Required 12 Years

Duration Contract program managementagile methodology

Implementation Officer
KINAL GLOBAL CARE PRIVATE LIMITED 0.00 to 4.00 Years Hyderabad,Latur, Chakan, Singapore, Puerto Rico, Saudi Arabia, Panaji, Senegal, Bhubaneswar, Uganda, 12 Nov, 2024

ob responsibilities: Design all job requirements and specifications and manage all communication with implementation analysts. Resolve all issues and develop all programs according to client ...
project managementimplementation planningimplementation experiencebusiness developmentsoftware installationorder managementstatistical modelingdata analysisproduct training

Physical Asset Engineer
Klaus IT Solutions Private Limited 1.00 to 3.00 Years Hyderabad,Bangalore, Chennai, Coimbatore 12 Nov, 2024

Physical Asset Verification Exp: - 1 - 3 yrs Shift timings: - 9AM - 6PM Working days: - 5 Days Location: - Bangalore, Coimbatore, Pune, Hyderabad 1-2 years of experience in physical asset verif...
physical verificationcommunication skillsexcelphysical asset managementsapreportingasset verification

Python full stack developer
Knack Consulting Services Private Limited 7.00 to 10.00 Years Hyderabad 12 Nov, 2024

Hi Applicant, I hope this message finds you well. We are currently hiring for a Python Full Stack Developer position in Hyderabad and thought you might be a great fit for this r...
djangopythonaws

Urgent Hiring For Linux or windows administrators with experience on puppet auto
ITSOURCE GLOBAL SERVICES PRIVATE LIMITED 8.00 to 12.00 Years Hyderabad,Bangalore, Chennai, Pune, Mumbai City 12 Nov, 2024

Dear Candidate, Urgent Vacancy For the below skills Linux, Windows administrators, Puppet and github Locations Pan india Ctc upto 42 LPA Need 30 days joiners Experience 8 to 12 yrs If inte...
linuxgithubpuppet

Documentum
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED 4.00 to 9.00 Years Hyderabad,Bangalore, Chennai, Noida, Gurugram, Kolkata, Pune, Mumbai City, Delhi 12 Nov, 2024

Skill: Documentum

Ability to design and architect solution on Documentum platform

Working knowledge on Webtop/DA, XCP/D2, DFC,WDK

Working experienc...
dfcwebtop

Senior Associate
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 9.00 Years Hyderabad,Bangalore, Chennai, Noida, Gurugram, Pune, Mumbai City, Delhi 12 Nov, 2024

Job description

The Product Development (PD) team within Morgan Stanley Fund Services (MSFS) is the change & transformation think tank that works with the fund services business...
financial reportingtest casesoperationsbusiness strategydata structuresvisioautomationcoding

Urgent Hiring for International Voice process WFO_HYD
Sahasya Global Solutions Private Limited 3.00 to 8.00 Years Hyderabad 12 Nov, 2024

Hiring for International Voice process Min 3 Year of experience into international voice process Qualification: 102/ 103/Graduates /PG Location: Hyderabad Package : Up to 7.5lpa Roles & resp...
customer serviceinternational voice processcustomer supportinternational bpo

Account Manager/ Customer Success manager
Axycube Solutions Pvt Ltd 3.00 to 8.00 Years Hyderabad,Bangalore, Chennai, Kolkata, Mumbai City 12 Nov, 2024

1. Position - Account Manager/ Customer Success manager 2. Location- Bangalore/ Mumbai/ Hyderabad/Kolkata. 3. Experience- 4- 8 years of relevant experience in selling Solutions/Services pertain...
it hardware salesamc

Medical Coder(Div 09)
Starworth Global Solutions 1.00 to 6.00 Years Hyderabad,Bangalore, Chennai 12 Nov, 2024

We are Hiring Medical Coders (IPDRG,Denial,Hcc.E&M IP/OP,ED) Exp 1 yrs in Medical coding Certified Or Non Certified (Any Certification ) location Chennai, Bangalore If Intrested surgeryhcc codingradiologymedical codinggeneral surgerye/m coding

Investment Counseller
AV Global Advisory Services 10.00 to 15.00 Years Hyderabad,Mumbai City 12 Nov, 2024

Hiring for Investment Counselor Experience- Minimum 10-15 years of relevant experience in Wealth Management, investment advisory in banks/ NBFC firms is must. Should be well versed in financial...
wealthinvestment advisoryinvestment counselor

Fashion Designer
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 5.00 to 10.00 Years Hyderabad,Bangalore, Noida, Chennai, Gurugram, Pune, Mumbai City, Delhi 12 Nov, 2024

Key Responsibilities:

Trend Research & Concept Development: Stay updated with global fashion trends, colors, and materials to inspire innovative collections. costume designingphotoshop

Ar Caller & Sr Ar Caller
Starworth Global Solutions 1.00 to 4.00 Years Hyderabad,Bangalore, Chennai 12 Nov, 2024

EXECUTIVE AR / SR EXECUTIVE AR Note: Freshers please ignore this Experience - 1 to 5 years in VOICE PROCESS *Physician billing, Hospital billing, credentials and appeals **voice process only* ...
ar callingdenial managementar calling medical billingphysician billingsr ar executive

CONTRACT TO HIRE - SailPoint Implementation (IIQ) consultant
Shell Info Technologies Pvt Ltd 5.00 to 8.00 Years Hyderabad,Bangalore, Chennai, Gurugram, Kolkata, Pune, Mumbai City 12 Nov, 2024

Key Job Description/Responsibilities:

Design, Develop and Deploy SailPoint IIQ implementation(s).

Contribute to the Requirements Gathering activities.
...
integration testingsailpoint iiqsailpoint iam

Medical Coding - General Life Science , clinical nutrition Grad -CT Priya
Alpha Medical Coding Solutions 0.00 to 2.00 Years Hyderabad,Thanjavur, Bangalore, Madurai, Chennai, Salem, Thoothukudi, Tiruchirappalli, Vellore, Coim 12 Nov, 2024

Medical Coding Job CT HR Gokulapriya-hidden_mobile(Whatsapp ) Position: Medical Coder pharmacymedical codingbiotechnologybptmptphysiotherapybiochemistrynursingzoology

Medical Coding Freshers for BPT, MPT, Physiotherapy -CT Priya
Alpha Medical Coding Solutions 0.00 to 2.00 Years Hyderabad,Thanjavur, Madurai, Bangalore, Chennai, Salem, Thoothukudi, Tiruchirappalli, Vellore, Coim 12 Nov, 2024

Medical Coding Job CT HR Gokulapriya-hidden_mobile(Whatsapp ) Position: Medical Coder mptbiomedicalbiochemistryzoologymedical codingbiotechnologybptnursingpharmacy

Implementation Executive
KINAL GLOBAL CARE PRIVATE LIMITED 5.00 to 10.00 Years Gurugram,Faridabad, Singapore, Surat, Puerto Rico, Saudi Arabia, Senegal, Uganda, Peru, Rajahmundry, 12 Nov, 2024

ob responsibilities: Design all job requirements and specifications and manage all communication with implementation analysts. Resolve all issues and develop all programs according to client ...
project managementimplementation planningimplementation experiencebusiness developmentsoftware installationorder managementstatistical modelingdata analysisproduct training

Wanted Staff Nurse Male/female,Gnm,Dgnm,Bsc Nurse Students in Chennai
ACHIEVERS SPOT Hiring For Medical Coding 0.00 to 1.00 Years Erode,Madurai, Coimbatore, Chennai, Ramanathapuram, Pudukottai, Salem, Vellore, Nagercoil, Dharmapur 12 Nov, 2024

Position: Medical Coder Ct: HR Shanmugapriya hidden_mobile We are looking for a DGNM Staff nurse Efficiently P...
nursingbptbiomedical engineersstaff nursepharmaceutical technologypharmacistmedical coding intern

for B.Sc, MSc, Mphil Zoology,Biology, Botany Freshers Experienced Students
ACHIEVERS SPOT Hiring For Medical Coding 0.00 to 2.00 Years Erode,Madurai, Coimbatore, Chennai, Ramanathapuram, Pudukottai, Kanyakumari, Krishnagiri, Dharmapuri 12 Nov, 2024

Job Description Position: Medical Coder Ct: HR Mythili-hidden_mobile Medical Coding is the process of conversion of text information related to heal...
nursingdieteticsbiotechnologymicrobiologybioinformaticsphysiotherapypharmacymedical codingbiochemistrybiologydmltzoologybiomedicalbotanynutriitionmsc zoologybsc biologybsc botanymphil botanydentistbsc zoologymedical coding internmedi

Fashion Designer
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 5.00 to 10.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Pune, Mumbai City 12 Nov, 2024

Key Responsibilities:

Trend Research & Concept Development: Stay updated with global fashion trends, colors, and materials to inspire innovative collections. costume designingphotoshop

Project Coordinator
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 9.00 Years Gurugram,Noida, Bangalore, Chennai, Hyderabad, Pune, Mumbai City 12 Nov, 2024

Understand a projects scope and create documents for project requirements

Conduct project meetings to communicate individual roles, project expectations, a...
project managementsmart plant reviewcaesar iiautocadpiping engineeringpdms

Implementation Executive
KINAL GLOBAL CARE PRIVATE LIMITED 5.00 to 10.00 Years Gurugram,Faridabad, Singapore, Surat, Puerto Rico, Saudi Arabia, Senegal, Uganda, Peru, Rajahmundry, 12 Nov, 2024

ob responsibilities: Design all job requirements and specifications and manage all communication with implementation analysts. Resolve all issues and develop all programs according to client ...
project managementimplementation planningimplementation experiencebusiness developmentsoftware installationorder managementstatistical modelingdata analysisproduct training

Sales Associate
Orbit Global HR Consultants Hiring For sales Associate 0.00 to 4.00 Years Gurugram 12 Nov, 2024

Hiring For Associate Sales Consultant Location :- Gurgaon, Haryana Job Responsibilities :- 1. Assisting customers in the sale of a range of financial products on the phone. ...
graduatesalestelesalesbpooutbound salesupsellingcold callingnight shifttelecalling

Head Logistics
FRONTLINE TECH JOB CONSULTANTS 15.00 to 25.00 Years Gurugram,Noida, Bangalore, Hyderabad, Pune 12 Nov, 2024

Job description Responsibilities:

Manage end to end supply chain processes which includes inventory management, warehousing, logistics and distribution.
material managementlogistics managementwarehouse operations

Data Scientist
MAVINSYS GLOBAL PRIVATE LIMITED 6.00 to 10.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 12 Nov, 2024

Statistical Analysis & Data Modeling: Use advanced statistical techniques such as forecasting, time series analysis, trend an...
data modelingforecasting skills

Implementation Executive
KINAL GLOBAL CARE PRIVATE LIMITED 5.00 to 10.00 Years Gurugram,Faridabad, Singapore, Surat, Puerto Rico, Saudi Arabia, Senegal, Uganda, Peru, Rajahmundry, 12 Nov, 2024

ob responsibilities: Design all job requirements and specifications and manage all communication with implementation analysts. Resolve all issues and develop all programs according to client ...
project managementimplementation planningimplementation experiencebusiness developmentsoftware installationorder managementstatistical modelingdata analysisproduct training

Salesforce Vlocity- Lead, Architect(PAN INDIA)
Wroots Global Private Limited 7.00 to 12.00 Years Gurugram,Delhi, Bangalore 12 Nov, 2024

Minimum one full cycle project implementations in Vlocity required Strong experience in Vlocity implementation in Telecom or Healthcare domain Lightning web comonen...
salesforcevlocity

Technical Program Manager - Contract for 6 to 12 Months
LAGRAN SOFTWARE SOLUTIONS PRIVATE LIMITED 12.00 to 22.00 Years Gurugram,Hyderabad 12 Nov, 2024

Job Position (Title) Technical Program Manager

Experience Required 12 Years

Duration Contract program managementagile methodology

Documentum
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED 4.00 to 9.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 12 Nov, 2024

Skill: Documentum

Ability to design and architect solution on Documentum platform

Working knowledge on Webtop/DA, XCP/D2, DFC,WDK

Working experienc...
dfcwebtop

Filenet Developer & Administration
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED 4.00 to 9.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Navi Mumbai, Kolkata, Pune, Mumbai City 12 Nov, 2024

Location- PAN INDIA SKill- FileNet

Experience on FileNet Development & Administration,

Experience with Databases Oracle / MSSQL

...
oraclefilenet

Life Insurance Relationship Managers
ConnectIN Jobs Global 1.00 to 5.00 Years Erode,Other Tamil Nadu 12 Nov, 2024

Insurance sales through assigned Bank Branches. Coordinating between Bank and company from Lead generation to policy conversion. Follow up with Operations of Banks. To build mutually beneficial...
Insurance SalesBankingLead GenerationMentoringSalesCustomer Requirement Gathering

Wanted Staff Nurse Male/female,Gnm,Dgnm,Bsc Nurse Students in Chennai
ACHIEVERS SPOT Hiring For Medical Coding 0.00 to 1.00 Years Erode,Madurai, Coimbatore, Chennai, Ramanathapuram, Pudukottai, Salem, Vellore, Nagercoil, Dharmapur 12 Nov, 2024

Position: Medical Coder Ct: HR Shanmugapriya hidden_mobile We are looking for a DGNM Staff nurse Efficiently P...
nursingbptbiomedical engineersstaff nursepharmaceutical technologypharmacistmedical coding intern

for B.Sc, MSc, Mphil Zoology,Biology, Botany Freshers Experienced Students
ACHIEVERS SPOT Hiring For Medical Coding 0.00 to 2.00 Years Erode,Madurai, Coimbatore, Chennai, Ramanathapuram, Pudukottai, Kanyakumari, Krishnagiri, Dharmapuri 12 Nov, 2024

Job Description Position: Medical Coder Ct: HR Mythili-hidden_mobile Medical Coding is the process of conversion of text information related to heal...
nursingdieteticsbiotechnologymicrobiologybioinformaticsphysiotherapypharmacymedical codingbiochemistrybiologydmltzoologybiomedicalbotanynutriitionmsc zoologybsc biologybsc botanymphil botanydentistbsc zoologymedical coding internmedi

Wanted Staff Nurse Male/female,Gnm,Dgnm,Bsc Nurse Students in Chennai
ACHIEVERS SPOT Hiring For Medical Coding 0.00 to 1.00 Years Erode,Madurai, Coimbatore, Chennai, Ramanathapuram, Pudukottai, Salem, Vellore, Nagercoil, Dharmapur 12 Nov, 2024

Position: Medical Coder Ct: HR Shanmugapriya hidden_mobile We are looking for a DGNM Staff nurse Efficiently P...
nursingbptbiomedical engineersstaff nursepharmaceutical technologypharmacistmedical coding intern

for B.Sc, MSc, Mphil Zoology,Biology, Botany Freshers Experienced Students
ACHIEVERS SPOT Hiring For Medical Coding 0.00 to 2.00 Years Erode,Madurai, Coimbatore, Chennai, Ramanathapuram, Pudukottai, Kanyakumari, Krishnagiri, Dharmapuri 12 Nov, 2024

Job Description Position: Medical Coder Ct: HR Mythili-hidden_mobile Medical Coding is the process of conversion of text information related to heal...
nursingdieteticsbiotechnologymicrobiologybioinformaticsphysiotherapypharmacymedical codingbiochemistrybiologydmltzoologybiomedicalbotanynutriitionmsc zoologybsc biologybsc botanymphil botanydentistbsc zoologymedical coding internmedi

Lead Electrical
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 5.00 to 10.00 Years Delhi,Noida, Bangalore, Chennai, Hyderabad, Gurugram, Pune, Mumbai City 12 Nov, 2024

Responsibilities for lead electrical engineer

Preparation of standards / specifications for the discipline

Assume ot...
communication skillsteam leadershipproject executionproject managementlead electrical

Data Scientist
MAVINSYS GLOBAL PRIVATE LIMITED 6.00 to 10.00 Years Delhi,Noida, Bangalore, Chennai, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City 12 Nov, 2024

Statistical Analysis & Data Modeling: Use advanced statistical techniques such as forecasting, time series analysis, trend an...
data modelingforecasting skills

Business System Analyst
FACILITY PLUS SERVICES 6.00 to 10.00 Years Delhi 12 Nov, 2024

About the role As the Finance Business Systems Analyst, you will be responsible for driving improvements in the processes and technologies utiliz...
concursapnetsuite

Sr Engineer/Assistant Manager - Technical Support IOT Global Service Operations
Vision India Services Private Limited 10.00 to 15.00 Years Noida 12 Nov, 2024

Responsibilities: As a Technical support engineer, you will provide technical support to customers world-wide. Will demonstrate excellent interpersonal skills while troubleshooting techn...
wcdmacore network

Hiring for 18 international bpo, US SHIFT,UK SHIFT SAL UP TO 64k
Imaginators Try Going Beyond Hiring For Customer service 1.00 to 6.00 Years Delhi,Noida, Gurugram 12 Nov, 2024

Hi Hiring for 35 international bpo,AUS SHIFT,UK SHIFT SAL UP TO 64k we are hiring for top international bpo for voice process uk shift,us shift sal 17k-64K profice customer service, collect...
bpotraveltechnicalinternational call centercpsinternationalretailairtechnology

Filenet Developer & Administration
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED 4.00 to 9.00 Years Delhi,Noida, Bangalore, Chennai, Hyderabad, Navi Mumbai, Gurugram, Kolkata, Pune, Mumbai City 12 Nov, 2024

Location- PAN INDIA SKill- FileNet

Experience on FileNet Development & Administration,

Experience with Databases Oracle / MSSQL

...
oraclefilenet

Opening for Admission Officer - Noida Sector 16
ALK Staffing Solutions Pvt Ltd 1.00 to 6.00 Years Delhi,Noida 12 Nov, 2024

UNext is a next generation online learning organisation focused on the higher education ecosystem. UNext aims to solve for improving access, increasing affordability, providing good quality cont...
lead generationadmission officeracademic counsellor

Qa Automation Sales Force side, Wipro location Pan India, Immediate Joiners only
ITSOURCE GLOBAL SERVICES PRIVATE LIMITED 5.00 to 10.00 Years Delhi,Noida, Bangalore, Chennai, Hyderabad, Kolkata, Gurugram, Pune 12 Nov, 2024

QA AUTOMATION: Mandatory Skills - Salesoforce Automation Selenium Java BDD cucumber.

Experience Minimum 5 Years of Salesforce Automation Testing

Sk...
cucumberseleniumjavasalesforceautomation testing

PREV
NEXT

global technology Job Openings

Responsibilities Design compensation and benefits packages Implement performance review procedures (e.g. quarterly/annual and 360 evaluations) Develop fair HR po... executioncommunication skillsstrategyadvisingcreation

Job description The Product Development (PD) team within Morgan Stanley Fund Services (MSFS) is the change & transformation think tank that works with the fund services business... financial reportingtest casesoperationsbusiness strategydata structuresvisioautomationcoding

Key Responsibilities:

Key Responsibilities:

Job description Responsibilities: Manage end to end supply chain processes which includes inventory management, warehousing, logistics and distribution. material managementlogistics managementwarehouse operations

About the role As the Finance Business Systems Analyst, you will be responsible for driving improvements in the processes and technologies utiliz... concursapnetsuite

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Responsibilities

Design compensation and benefits packages

Implement performance review procedures (e.g. quarterly/annual and 360 evaluations)

Develop fair HR po...
executioncommunication skillsstrategyadvisingcreation

Job description

The Product Development (PD) team within Morgan Stanley Fund Services (MSFS) is the change & transformation think tank that works with the fund services business...
financial reportingtest casesoperationsbusiness strategydata structuresvisioautomationcoding

Job description Responsibilities:

Manage end to end supply chain processes which includes inventory management, warehousing, logistics and distribution.
material managementlogistics managementwarehouse operations

About the role As the Finance Business Systems Analyst, you will be responsible for driving improvements in the processes and technologies utiliz...
concursapnetsuite