google sheets jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

google sheets Job Openings

Showing 6851 - 6900 of 7264 Jobs

Hire Posted for _Site Reliability Engineering

GFL RECRUITMENT PRIVATE LIMITED 0.00 to 3.00 Years Chennai 16 Oct, 2023

Job Description

Help...
networkinggoogle cloud platform

We are hiring Accountant Finance Cashier Data Entry Dubai UAE

Always International Manpower Service Hiring For Accountant Data Entry Cashier Sales Job in Dubai 1.00 to 5.00 Years Chennai 16 Oct, 2023

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Complying with all company,...
accountinglogistic regressiondocument controldata entrysales processcashiersdata analysisaccount managementcashier activities

Java Project Manager

Infosys Limited 5.00 to 11.00 Years Chennai 16 Oct, 2023

subject matter experts

software development methodologies

.Net Project Manager

Infosys Limited 5.00 to 13.00 Years Chennai 16 Oct, 2023

subject matter experts

identifying new opportunities

software development methodologies

Bulk Hiring for Domestic Customer Support

Wroots Global Private Limited 0.00 to 5.00 Years Bangalore 16 Oct, 2023

domestic voice process

customer service operations

telecalling

inbound voice process

Urgent hiring in Life insurance Bancassurance-CTC-3lac to 5lac

RELIANCE NIPPON LIFE INSURANCE COMPANY LIMITED 1.00 to 6.00 Years Bangalore 16 Oct, 2023

Channel-Bancassurance

CTC-3lac to 5lac

We are hiring for Relationship Officer Bancassurance in Mumbai Maharashtra f...
unitmangersrm

Data Entry operator / Part Time / Typing
Fondstaff Private Limited 0.00 to 3.00 Years Vishakhapatnam 12 Oct, 2023

Laptop/Desktop & Smartphone are required. Training will beprovided No Target work. Desired skills and qualities: Fresher and experience both can apply. 12th pass or any Graduate can apply. Basic...
data entryback officepart timebackendonline data entrytypingwork from home typing

Opening for senior accountant dubai
Always International Manpower Service Hiring For Accountant Data Entry Cashier Sales Job in Dubai 1.00 to 5.00 Years Rajahmundry 12 Oct, 2023

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Complying with all company,...
document controlaccountingdata entrysalescashierslogistic regressionsales process

Digital Marketing Manager in All Cities
GFL RECRUITMENT PRIVATE LIMITED 1.00 to 4.00 Years Pune 12 Oct, 2023

digital marketing campaigns across all digital ECOMMERCE channels. You must have experience with planning digital marketing campaigns, including web, SEO/SEM, email, social media and display adve...
seoecommerce developmentsocial media marketingppc

Social Media Marketing Manager in All Cities
GFL RECRUITMENT PRIVATE LIMITED 1.00 to 4.00 Years Pune 12 Oct, 2023

digital marketing campaigns across all digital ECOMMERCE channels. You must have experience with planning digital marketing campaigns, including web, SEO/SEM, email, social media and display adve...
digital marketingecommerce developmentppcseo

Gen AI- Developer
Infosys Limited 0.00 to 2.00 Years Pune 12 Oct, 2023

Gen AI Technologies: Prompt Engineering, LLM Development using Langchain. Semantic Kernel , Open Source/ API based LLMs . Python Data Science, Machine Learning, Deep Learning, PySpark, PyTorch, Te...
natural language processingdata sciencedeep learningcloud computingdata collectioncomputer visionneural networksmachine learningnatural languagespeech processinglanguage processingdata representationstatistical analysisapiawsrestclou

Stores Assistant Store in-charge in Dubai
Always International Manpower Service Hiring For Accountant Data Entry Cashier Sales Job in Dubai 1.00 to 5.00 Years Nagpur 12 Oct, 2023

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Complying with all company,...
data entrydocument controlsalesaccountingsales processlogistic regressioncashier activitiescashiersaccount management

HR Executive cum Admin
LIVE-WIRE CONSULTANCY SERVICES 1.00 to 3.00 Years Noida 12 Oct, 2023

Hiring:HR ExecutiveCumAdmin Position:2 Location: Delhi/NCR Salary: 20hidden_mobile0 General Admin Responsibilities: Create and update records and databases with pe...
human resource managementhr operations

Digital Marketing Manager in All Cities
GFL RECRUITMENT PRIVATE LIMITED 1.00 to 4.00 Years Noida 12 Oct, 2023

digital marketing campaigns across all digital ECOMMERCE channels. You must have experience with planning digital marketing campaigns, including web, SEO/SEM, email, social media and display adve...
seoecommerce developmentsocial media marketingppc

Immediately hire for Data Entry Cashier and Sales in Dubai apply now
Always International Manpower Service Hiring For Accountant Data Entry Cashier Sales Job in Dubai 1.00 to 5.00 Years Mysore 12 Oct, 2023

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Complying with all company,...
data analysiscashier activitiessalesaccountingdocument controlcashiersaccount managementdata entrylogistic regression

Java Springboot Lead
Infosys Limited 2.00 to 6.00 Years Mysore 12 Oct, 2023

We are seeking a highly experienced Java & Springboot Developer to join our team as a Team Leader. As a Team Leader, you will be responsible for leading and mentoring a team of Java & Springboot D...
software development methodologiesspring dataunit testingteam handlingsystem designdata migrationcloud computingdata structuresproblem solvingversion controlcomputer sciencejava performancecoding standardsmanagement skillsdevelopment tools

We Hiring For HR Operation manufacturing plant_30K_Kandivali
Job Drive HR Consultants 1.00 to 4.00 Years Mumbai City 12 Oct, 2023

We Hiring For HR Generalist Role into reputed manufacturing company.

Job Role:-

Managing the companys staff attendance, outdoor books etc both physically as well as through t...
exit formalitieshr generalist activitiesjoiningsoperations

Urgent Hiring For Accountant, Cashier, Banking Operation, Finance Analyst
Kartik Kumar Joshi Hiring For Gita Consultancy 0.00 to 1.00 Years Kochi 12 Oct, 2023

Accountant Responsibilities:- Complying with the company, state, and country accounting and financial regulations. Compiling, analysing, and reporting financial data. Creating...
account managementaccountingbanking productscashiersbanking operationscash handling

Stores Assistant Store in-charge in Dubai
Always International Manpower Service Hiring For Accountant Data Entry Cashier Sales Job in Dubai 1.00 to 5.00 Years Kochi 12 Oct, 2023

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Complying with all company,...
data entrydocument controlsalesaccountingsales processlogistic regressioncashier activitiescashiersaccount management

GCP Architect
Infosys Limited 5.00 to 17.00 Years Hyderabad 12 Oct, 2023

A day in the life of an Infoscion As part of the Infosys delivery team, your primary role would be to provide best fit architectural solutions for one or more projects. You would also provide tech...
problem solvingdesign patternsperformance tuningthought leadershiparchitectural designsolution developmentdigital transformationcompetency developmentfitsdlcclouddesignsizingdatabasecomplianceleadershipperformancearchitectureconsultation

.Net Project Manager
Infosys Limited 5.00 to 13.00 Years Hyderabad 12 Oct, 2023

We are seeking a highly experienced .NET Project Manager to join our team. As a Project Manager, you will be responsible for leading and managing the development of .NET projects from start to fin...
deliveryproject managementcustomer relationsreportingjavasubject matter expertsidentifying new opportunitiessoftware development methodologiesproject planscloud computingproblem solvingversion controlproject planningagile methodologiessoftwa

Vendor Management New Associate-Procurement management
Accenture 0.00 to 1.00 Years Gurugram 12 Oct, 2023

Skill required: Procurement management - Vendor Management Designation: Vendor Management New Associate Job Location: G...
accounts payableaccounts payablereceivableapproval processbudgetingcreditroot causeissue resolutionvendor managementthought leadershipclient relationshipsupplier enablementcommunication skillsprofessional servicesperformance measurement

Sales Manager
Williams Consulting Pvt Ltd 2.00 to 4.00 Years Gurugram 12 Oct, 2023

Skills required:

Excellent written and spoken English with complete clarity in diction and

Motivated to learn, share and apply sales processes and<...
senior salesbusiness development

HR Executive cum Admin
LIVE-WIRE CONSULTANCY SERVICES 1.00 to 3.00 Years Gurugram 12 Oct, 2023

Hiring:HR ExecutiveCumAdmin Position:2 Location: Delhi/NCR Salary: 20hidden_mobile0 General Admin Responsibilities: Create and update records and databases with pe...
human resource managementhr operations

Accountant
RISEOM TOOL CRAFTS PRIVATE LIMITED 3.00 to 8.00 Years Delhi 12 Oct, 2023

We are seeking trustworthy candidates who work efficiently without sacrificing accuracy. Accountants can expect to work with large amounts of numerical data, handle multiple tasks with deadlines,...
industrycommunicationgoodadaptabilitycollaborationknowledgesummaryskillsefficiencytime-saving

Performance Marketing Executive | E-Store For Apparels & Handicrafts
Unnati 1.00 to 5.00 Years Delhi 12 Oct, 2023

Our client is a 5-year-old online platform where one can buy exclusive range of handcrafted clothing and accessories, home decor and more. Their textiles and designs range from Patola, Kalamkari...
ppcgoogle adwords

HR Executive cum Admin
LIVE-WIRE CONSULTANCY SERVICES 1.00 to 3.00 Years Delhi 12 Oct, 2023

Hiring:HR ExecutiveCumAdmin Position:2 Location: Delhi/NCR Salary: 20hidden_mobile0 General Admin Responsibilities: Create and update records and databases with pe...
human resource managementhr operations

Executive Assistant
Vibgyor Enterprises Hiring For Personal assistant 3.00 to 8.00 Years Delhi 12 Oct, 2023

Dear Candidate, Urgent opening forPersonal or Executive Assistant, for our end client (working into Financial and Agriculture domain- Mnc company) Working Location: Gur...
travel managementcalendar managementexecutive assistantpersonal secretarymeetings booking

Part -Full Time / Online Data Entry / Home-Based
Fondstaff Private Limited 0.00 to 3.00 Years Bangalore 12 Oct, 2023

Laptop/Desktop is required. Training will beprovided No Target work. Desired skills and qualities: Fresher and experience both can apply. 12th pass or any Graduate can apply. Basic Computer Know...
data entryonline data entrydata conversionwork from home typingservicebackendback office

Home Based / Data Entry / Day-Night Shift Hiring!
Fondstaff Private Limited 0.00 to 3.00 Years Vijayawada 10 Oct, 2023

Job description Good in Advance Excel, Vlook up, Hlook up, Pivat Table Maintaining Mis of Data Collation ,Compilation Analysis Data and provide data for sales forecast. Required Cand...
data analysisdata entry typingback office operationsmis operationsdata entrydata entry work from homeback office

Head Cashier in Dubai
Always International Manpower Service Hiring For Accountant Data Entry Cashier Sales Job in Dubai 1.00 to 5.00 Years Vishakhapatnam 10 Oct, 2023

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Complying with all company,...
cashiersaccount managementsales processaccountingsalesdata analysiscashier activitiesdocument controllogistic regression

Head Cashier in Dubai
Always International Manpower Service Hiring For Accountant Data Entry Cashier Sales Job in Dubai 1.00 to 5.00 Years Pune 10 Oct, 2023

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Complying with all company,...
cashiersaccount managementsales processaccountingsalesdata analysiscashier activitiesdocument controllogistic regression

Computer Operator
AppSoft Solutions 0.00 to 4.00 Years Nashik 10 Oct, 2023

Data Entry Operator Responsibilities:

Gathering, collating, and preparing documents, materials, and information for data entry.
<...
powerpointdata entrytallyms officemicrosoft excel

Immediately hire for Data Entry Cashier and Sales in Dubai apply now
Always International Manpower Service Hiring For Accountant Data Entry Cashier Sales Job in Dubai 1.00 to 5.00 Years Mangalore 10 Oct, 2023

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Complying with all company,...
data analysiscashier activitiessalesaccountingdocument controlcashiersaccount managementdata entrylogistic regression

Finance Executive Signage Industry - Mumbai
Morpheus Human Consulting Pvt Ltd 4.00 to 6.00 Years Mumbai City 10 Oct, 2023

Job Title: Finance Executive Signage Industry - Mumbai As an executive in the Finance Department, you will support the Finance team...
relationship managementsapaccountingtally

Media Buyer
HR Desire 5.00 to 10.00 Years Mumbai City 10 Oct, 2023

We have opening for Media Buyer, kindly find the job details below: Mandatory to fill: Tracker

Post Applied for media buyingpaid media

Web3 Growth Hacker in All Cities
GFL RECRUITMENT PRIVATE LIMITED 1.00 to 4.00 Years Hyderabad 10 Oct, 2023

digital marketing campaigns across all digital ECOMMERCE channels. You must have experience with planning digital marketing campaigns, including web, SEO/SEM, email, social media and display adve...
digital marketingppcseoecommerce development

Social Media Marketing Manager Hyderabad
GFL RECRUITMENT PRIVATE LIMITED 1.00 to 4.00 Years Hyderabad 10 Oct, 2023

digital marketing campaigns across all digital ECOMMERCE channels. You must have experience with planning digital marketing campaigns, including web, SEO/SEM, email, social media and display adve...
social media marketingdigital marketingppcecommerce development

Bus & Technology Delivery Associate-Digital Marketing
Accenture 1.00 to 3.00 Years Hyderabad 10 Oct, 2023

Skill required: Digital Marketing - Google Ads Designation: Digital Mktg Advisory Associate Job Location: Hyderabad accountsbillingbilling systemscmscommobile phone appsadobe creative suiteweb pagesproblem solvingwork managementcustomer servicedigital marketingonline advertisingdisplay advertisingverbal communicationprofessional servicesatlassian jira

Meta Marketing Manager
Sharda IT Services 3.00 to 4.00 Years Noida 10 Oct, 2023

Hiring Urgently

We are seeking a reliable Meta Marketing Manager and Executive to join our collaborative team at Flight Blues Pvt Ltd at Noida.

Growing your career as a Full ...
kayakmarketingamadeusgooglemetaskyscanner

Bulk Hiring For Us,UK Travel Sales Consultant for Google campaign,Meta Search
Sharda IT Services 1.00 to 5.00 Years Gurugram 10 Oct, 2023

Hiringfor US and UK Travel Sales Consultant Exp min 1yr location Gurgaon, Noida, Delhi Salary upto 70k incentives Both Side cab meal Amadeus Is must Flight Sales Rotational Shift,Off Goo...
searchamadeustravelflightsalesppccampaigncallsholidaypackagemeta

Warehouse Supervisor Accountants in Dubai
Always International Manpower Service Hiring For Accountant Data Entry Cashier Sales Job in Dubai 1.00 to 5.00 Years Bangalore 10 Oct, 2023

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Complying with all company,...
cashiersaccount managementsales processaccountingsalesdata analysiscashier activitiesdocument controllogistic regression

PPC Executive Digital Marketing Manager in Ahmedabad
GFL RECRUITMENT PRIVATE LIMITED 1.00 to 4.00 Years Ahmedabad 10 Oct, 2023

digital marketing campaigns across all digital ECOMMERCE channels. You must have experience with planning digital marketing campaigns, including web, SEO/SEM, email, social media and display adve...
digital marketingecommerce developmentppcseo

Site Reliability Engineer (REMOTE)
GFL RECRUITMENT PRIVATE LIMITED 0.00 to 3.00 Years Mumbai City 06 Oct, 2023

Job Description
We are looking for site reliability engineers or system admins, who have experience and expertise in managing production servers at scale. You will be:

Help...
google cloud platformlinux

Drafts Man
Karnataka Information Solution 0.00 to 4.00 Years Chennai 06 Oct, 2023

We are hiring for Draftsman Qualification : Graduate or Minimum Intermediate with Autocad Knowledge Job Types : Fresher, Experienced Responsibilities of candidates include: Candidates should...
civil designelectrical designgoogle sketchupmechanical designautocad drafting

Site Reliability Engineer (REMOTE)
GFL RECRUITMENT PRIVATE LIMITED 0.00 to 3.00 Years Chennai 06 Oct, 2023

Job Description
We are looking for site reliability engineers or system admins, who have experience and expertise in managing production servers at scale. You will be:

Help...
google cloud platformlinux

Social Media Marketing Manager in All Cities
GFL RECRUITMENT PRIVATE LIMITED 1.00 to 4.00 Years Noida 04 Oct, 2023

digital marketing campaigns across all digital ECOMMERCE channels. You must have experience with planning digital marketing campaigns, including web, SEO/SEM, email, social media and display adve...
digital marketingppcseoecommerce development

Assistant Sales Manager
GURU NANAK SCAFFOLDINGS 5.00 to 10.00 Years Gurugram 04 Oct, 2023

Assistant Sales Manager (Job Description)

Build & maintain relationships with existing as well as potential clients, understanding their needs...
negotiation skillscommunication skillsms officeteam handlinggoogle sheets

Web3 Growth Hacker in All Cities
GFL RECRUITMENT PRIVATE LIMITED 1.00 to 4.00 Years Mumbai City 04 Oct, 2023

digital marketing campaigns across all digital ECOMMERCE channels. You must have experience with planning digital marketing campaigns, including web, SEO/SEM, email, social media and display adve...
digital marketingppcseoecommerce development

Web3 Growth Hacker Mumbai
GFL RECRUITMENT PRIVATE LIMITED 1.00 to 4.00 Years Mumbai City 04 Oct, 2023

digital marketing campaigns across all digital ECOMMERCE channels. You must have experience with planning digital marketing campaigns, including web, SEO/SEM, email, social media and display adve...
social media marketingdigital marketingppcecommerce development

PREV
NEXT

google sheets Job Openings

Job Description

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Skills required:

Job description Good in Advance Excel, Vlook up, Hlook up, Pivat Table Maintaining Mis of Data Collation ,Compilation Analysis Data and provide data for sales forecast. Required Cand... data analysisdata entry typingback office operationsmis operationsdata entrydata entry work from homeback office

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Data Entry Operator Responsibilities:

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Job Description

Job Description

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Job description Good in Advance Excel, Vlook up, Hlook up, Pivat Table Maintaining Mis of Data Collation ,Compilation Analysis Data and provide data for sales forecast. Required Cand...
data analysisdata entry typingback office operationsmis operationsdata entrydata entry work from homeback office