Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
JD-
Job Description Web Developer Skills Required :
Develop design briefs that suit the clients purpose; Produce new ideas and concepts - Develop interactive designs; Present finalized ideas and concepts to account managers; Work with a range of sof...
InDesignllustrativeskillsDevelopdesignViewsimilarjobs{@context:http://schema.org@type:JobPostingtitle:GraphicDesignerworkHours:hiringOrganization:CompanyHiddenvalidThrough:2019-08-15baseSalary:{@type:MonetaryAmountcurrency:INRvalue:{@type:QuantiKnowledge of Installation & Maintenance of Computer & Computer Networks - Create and supervise 3d product videos(Mobile phone launch video) - Corporate videos - Beautification of corporate presenta...
PhotoshopllustrataldrawModellingin3DsMaxViewsimilarjobs{@context:http://schema.org@type:JobPostingtitle:GRAPHICdesignerworkHours:hiringOrganization:CompanyHiddenvalidThrough:2019-08-15baseSalary:{@type:MonetaryAmountcurrency:INRvalue:{@type:Q
The candidate must be well versed with Photoshop editing and creating pages for various purposes. Good command over Photoshop and other related software. The candidate can be able to edit/create pamph...
illustrationtypographyraphicartistphotographyphotoshopgraphicdesignereditingpagelayoutphotoeditingDear Candidates, Opening for well known MNC. Designation : Graphic Designer Location : Khar Road Qualification : Any Graduate/Diploma/Degree in Graphic Designer Experience :2-3 year Salary upto ...
designationdesignadvertisingillustratoradobebrochureshtmlphotoshopsalarysoftwareoraldrawfrontendadobephotoshopsocialmediafrontenddesigngraphicdesignerLooking for candidate who has good experience in graphic designing, Photoshop, coral draw, illustrator. Exp in designing Banner,broucher, Mobile App, Web Pages,. to get your interview schedule mail ...
templatebrochuresphotoshopflyersillustratorosterdesigngraphicdesigningbannerdesigningbusinesscardswebpagescoraldrawwebpagedesignadobephotoshopgraphicdesignerWorking closely with the Digital Marketing team to understand the design needs Creating and editing Product videos, animation and graphics/collaterals for all digital and offline media. Create excel...
IndesignPhotoshopdesigningllustratViewsimilarjobs{@context:http://schema.org@type:JobPostingtitle:GraphicDesignerworkHours:hiringOrganization:CompanyHiddenvalidThrough:2019-07-20baseSalary:{@type:MonetaryAmountcurrency:INRvalue:{@type:Quantitat
Dear Candidate, We have an urgent requirement for the position of Photoshop Editor . Morning Shift - (10 am tp 7 pm) Afternoon shift - (12 noon to 9 PM) Night Shift - (10 pm to 7 am) only male Com...
photoshopmageeditingmayaacademyphotoshopeditorimagecuttingcolorcorrectionillustratorskillmanmaximagecropingphotoeditingmaacimageeditorphotostudioarenaanimationgraphicdesigneroxfordphotolabPlacement Consultants in Noida, Placement Consultants in Gurgaon Graphic Designer Job Title : Graphic Designer Job Function : Design, Creative, User Experience UG - Any Graduate - Any Specialization P...
advertisingadobephotoshopdesignbrochuresphotoshopadobecreativesuiteuserexperiencemailraphicslayoutgraphicdesigningcreativedesigninginternettechnologiesdesignconceptualizationaldrawWe require Graphic Designer with knowledge of video editing. Must know how to use adobe illustrator, adobe photoshop (addition adobe premier or aftereffects for video creation) Location is Jaipur onl...
indesignphotoshopillustratorideoeditinggraphicdesignadobephotoshopcoreldrawadobeillustratorvideocreationgraphicdesigneradobepremieraftereffectsgraphicdesigningaftereffectsadobepremierepro
Dear Candidate, We are currently on a look out for Graphic Designer for our company Suger & Spice based in Gurugram. Location: Delhi (Vasant Vihar) Experience: 2 to 5 years Salary: Up to 3lac to...
illustratorindesignhtmlphotoshopjavascriptcssdreamweaveragemakergraphicdesignwebdesignergraphicdesigneruidesignercoreldrawvisualisergraphicdesigningwebdesigning
Urgent Requirement Male Female Graphic Designer for Preet Vihar, Delhi Salary:- 15k to 18k Exp.:- Min 1 Yr Loc:- Preet Vihar, Near Laxmi Nagar, Delhi Job Responsibilities:- Graphic Designer Job D...
designindesigncoreldrawillustratoranimationgraphicsdtpphotoshopcolorreativgraphicdesignerconceptdesignportfoliomanagementportfolioanalysisvisulizerpackaginggraphicscreativeartistgraphicdesigncreativedesignvisualdesigngraphicdesigningDesignation: Graphic Designer 1-3yr exp,Pune Location: Pune Experience:1-3yr Salary: 20k-25k Job Description: We are looking for a creative Graphic designer with up-to-date knowledge to interpret...
magazinesdesigncomillustratorsoftwarephotoshoprawinterpreteyeonfusionpackaginggmailsalarycoreldrawadobeaftereffectsgraphicdesignerportfolioexhibitionsstylistsJr. Graphic Designer- Digital Agency Job Summary Minimum 1 yr of Experience as Graphic Designer- Digital Agency Job Details Location Mahim, Mumbai Shift Timings 10:00 am - 7:00 pm(day shift) W...
photoshopillustratorindesigngraphicsraphicdesignbusinesscardsgraphicdesigninggraphicdesigner-digitalagencygraphicdesignsystems/softwaregraphicdesignermediagraphicdesignsoftwareweb/graphicdesign-digitalagencyillustrationdigitalgraphicdesigner
Greetings from doodle Designs !! We are looking candidate for Graphic Designer(INDESIGN Software) JD:
Selected interns day-to-day responsibilities include:
We require Graphic Designer with knowledge of video editing. Must know how to use adobe illustrator, adobe photoshop (addition adobe premier or aftereffects for video creation) Location is Jaipur onl...
adobephotoshopdesignillustratorraphicdesigningdrawaftereffectsgraphicdesignergraphiccorelvideocreationvideoeditingWalkin Drive on 10 May 2019, 1pm-4pm Contact Person - Neha Saxena (n.saxena@cvent.com) Cvent is looking for a brilliant Web & Graphic Designer with strong aesthetic sense and graphic designing skills...
html graphic designing graphics css javascript web designing webdesigner graphicdesigner Photoshop Illustrator Dreamweaver web designer graphic designerProven graphic designing experience Ability to interact, communicate, and present ideas Up-to-date with MS OFFICE software and (Word, PowerPoint, Excel, Outlook) Proficiency in creating/working on ...
graphic designing graphicdesigner photoshop illustrator indesign ms office power point MS Word ms excelWe are looking for talented Graphic Designers...
banners graphic designing graphicdesigner webdesigner web designing photoshop illustrator pagemaker coreldraw flash dreamweaverAn opening exists of a Graphic Designer for a medical device manufacturing unit. Location - Noida Salary - 8-10 K Experience - 1-2 years Freshers may apply Profile -Highly creative and multitalent...
designadobeillustratorphotoshopraphiccorelgraphicdesignermultimediagraphicdesignerdrawJob Description We are looking for a Graphic designer who is a creative thinker and with up-to-date knowledge to design solutions with high visual impact. You will work on a variety of product...
designphotoshopadobeebdesigningcoreldrawbusinesscardsuiuxdesignerbrochuredesignuiuxdesignuserinterfacedesigninguidesignemailerdesigncorellogodesigngraphicdesignuiuxdesignergraphicdesignerdrawnewsletterdesigngraphicdesigningbannerdesign
Graphic Designer Job Duties:
Selected interns day-to-day responsibilities include: 1. Working on creating synergy between all brand assets - sales brochures, visiting cards, company portfolio, website outlook 2. Creating design...
designillustratoradobemerchandisingbrochuresoperationsphotoshopdesigningbrandingogodesignpackaginggraphicsgraphiccoreldrawvisualgraphicdesignerExaminer have to conduct the examination in the following domain: Understand requirements and plan workflow Understanding requirements for post-production Planning the process for post-production. ...
photoshopflashisualdesigngraphicdesignergraphicdesigningvisualeditorsoundforgevisualbuildJob Description:
Roles & Responsibilities:
Examiner have to conduct the examination in the following domain: Understand requirements and plan workflow Understanding requirements for post-production Planning the process for post-production. ...
photoshopflashisualdesigngraphicdesignergraphicdesigningvisualeditorsoundforgevisualbuild
We have an Urgent opening for Graphic Designer - (Elearning) Articulate Storyline (3/360) for CMMIL5 MNC Company For Pune Location.
Hi All, We are having an immediate opening for GraphicDesigner @ CMMIL5 MNC Company in Punelocation Position : GraphicDesigner Location : Phursungi, Pune Experience : 2+ Years Job Description designphotoshopraphicgraphicdesigningcaptivategraphicdesignerelearninglectoraarticulatestoryline
Greetings from doodle Designs !! We are looking candidate for Graphic Designer(INDESIGN Software) JD:
© 2019 Hireejobs All Rights Reserved