Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
Hands on experience with Adobe Photoshop, Adobe Illustrator, HTML, CSS, jQuery, bootstrap. Good communication skills. Ability to troubleshoot issues and work in a team. Flexible with working hours. ...
adobe photoshopadobe illustrator cssmar htmladobe bonusjquery photoshopillustrator
SALARY: 2LPA-3LPA LOCATION : Mumbai,Maharahstra,India VACANCIES: 2 QUALIFICATION: Any Graduate MALE/FEMALE: Both EXPERIENC...
graphicdesigning webdesigning visualiser graphicdesign raphicdesigner webdesigner UIdesigner
Undertake Custom Projects under team guidance. UI Developer will architect and lead the UI implementation of a modern commercial web & Mobile Application UI Developer needs to be flexible, innovativ...
stronginterpersonalskills productdesign customprojects technicaldesign businessanalysis thoughtleadership softwaredevelopment interpersonalskills competitivelandscape andsontechnical perf mancetestingUndertake Custom Projects under team guidance. UI Developer will architect and lead the UI implementation of a modern commercial web & Mobile Application UI Developer needs to be flexible , innovati...
stronginterpersonalskills productdesign teammanagement adobephotoshop customprojects computerscience technicaldesign businessanalysis agiledevelopment thoughtleadership keffectively perf mancetesting
Undertake Custom Projects under team guidance. UI Developer will architect and lead the UI implementation of a modern commercial web Mobile Application UI Developer needs to be flexible, innovative an...
stronginterpersonalskills productdesign adobephotoshop customprojects computerscience technicaldesign businessanalysis thoughtleadership softwaredevelopment evelopmentw perf mancetesting interpersonaSALARY: 30k LOCATION : Navi mumbai VACANCIES: 1 QUALIFICATION: B.com MALE/FEMALE: Both EXPERIENCE: 3-4 JOB...
graphicdesigning webdesigning visualiser graphicdesign raphicdesigner webdesigner UIdesignerSALARY: 2LPA-3LPA LOCATION : Mumbai,Maharahstra,India VACANCIES: 2 QUALIFICATION: Any Graduate MALE/FEMALE: Both EXPERIENC...
graphicdesigning webdesigning visualiser graphicdesign raphicdesigner webdesigner UIdesignerDear Candidates, Opening for well known MNC. Designation : Graphic Designer Location : Borivali Experience : 2-3 year Salary upto 2.5 3L PA Job Description
Dear Candidate, Greetings of the day! We are looking for UI Designer at Kanjurmarg at MNC Leading Broking Firm Kindly go through the above JD Profile :-UIDesigner Location :- Kanjurmarg CTC :- A...
ser interface designingjava scriptweb ui designerseocssweb designweb designingcss 2.1/3angular jsui designajaxhtml / html 5
Dear Candidate, We are currently on a look out for Graphic Designer for our company Suger & Spice based in Gurugram. Location: Delhi (Vasant Vihar) Experience: 2 to 5 years Salary: Up to 3lac to...
illustratorindesignhtmlphotoshopjavascriptcssdreamweaveragemakergraphicdesignwebdesignergraphicdesigneruidesignercoreldrawvisualisergraphicdesigningwebdesigning
We are in Requirement of Graphic Designer (Mumbai). Projects in hand - 1.Package designing 2.Marketing collateral designing 3.Presentation designing 4.UI designing....
designphotoshopillustratormarketingadobepresentationdesigningrawuidesigneruserinterfacedesigningcorelgraphicWe are in Requirement of Graphic Designer (Mumbai). Projects in hand - 1.Package designing 2.Marketing collateral designing 3.Presentation designing 4.UI designing....
designphotoshopillustratormarketingadobepresentationdesigningrawuidesigneruserinterfacedesigningcorelgraphic
Designation - Graphic Designer Experience - 1 to 3yrs Salary- 10 to 20 k Location - Pune JD Graphics-UIDesigner we are looking for an experiencedGraphicDesigner. We expect the candidate to have m...
designinggraphicsphotoshopdesignadobebrochuresillustratororelgraphicdraw
We are looking for an UI/UX Developer who is motivated to combine the art of design with the art of programming. Responsibilities will include translation of the UI/UX designs and wireframes to actual...
css3ajaxphotoshopdreamweaverbootstrapflashjavascriptsoftwarearthtmlcssjquerylanguagedesignadobeyperuidevelopmentexperienceuidesignermarkuptextuxdesigneruserDear Candidate, Greetings fromJust see info Service Pvt Ltd, Post of Web Designer COMPANY DESCRIPTION Just See Chennais No.1 Local Search Engine & Digital Marketing Company. Its office...
htmlcssphotoshopuidesignerhtmldesignerwebdesignerWe are looking for smart and enthusiastic Front-end developer who has experience in Healthcare domain. The focus of this position is to work closely with the team to clearly be able to understand the ...
mvcangular6uidesignerfrontenddevelopment
© 2019 Hireejobs All Rights Reserved