ms office proficient jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

ms office proficient Job Openings

Showing 15301 - 15350 of 43209 Jobs

Hiring Data entry typist | Data Entry operator work, WFH

Divine HR Services 0.00 to 1.00 Years Hyderabad,Warangal, Machilipatnam, Tiruchirappalli, Other Uttarakhand, Kollam, Mysore, Thiruvanantha 01 Apr, 2025

back office operations

Backed office executive, anyone can apply

Aspect Solution 0.00 to 1.00 Years Hyderabad,Gulbarga, Other Telangana, Bangalore, Dehradun, Other Tamil Nadu, Nellore, Agartala, Other 01 Apr, 2025

excel

back office

data entry

Part-time Data Entry Associate Remote work

Divine HR Services 0.00 to 1.00 Years Hyderabad,Warangal, Other Assam, Thirunelveli, Mohali, Chennai, Nellore, Vijayawada, Agartala, Manga 01 Apr, 2025

data entry

back office

back office operations

part time

computer operating

english writing

Data Entry Clerk

APEX TRADING & SOFTECH SOLUTIONS Hiring For APEX TRADING SOFTECH SOLUTIONS 0.00 to 1.00 Years Hyderabad,Indore, Noida, Lucknow, Gurugram, Pune, Mumbai City, Delhi, Vadodara, Bhopal 01 Apr, 2025

data entry

data entry operation

back office operations

computer operating

data entry work from home

Area Sales Manager

Transformatrix Global Private Limited 6.00 to 11.00 Years Hyderabad 01 Apr, 2025

Data Entry from home - No Experience Needed

VRD INFOTECH 0.00 to 1.00 Years Hyderabad,Bangalore, Noida, Chennai, Kolkata, Gurugram, Pune, Mumbai City, Delhi, Bhopal 01 Apr, 2025

data entry

excel

back office

Data Entry Executive Work For Freshers,Part time work

VRD INFOTECH 0.00 to 1.00 Years Hyderabad,Bangalore, Chennai, Noida, Gurugram, Kolkata, Pune, Mumbai City, Delhi, Bhopal 01 Apr, 2025

excel

typing

data entry

Process Associate

STRYDE CONSULTING SERVICES Fresher Hyderabad 01 Apr, 2025

icse

excellent communication

Operations Manager

WorkMint 0.00 to 4.00 Years Hyderabad,Guntur, Rajahmundry, Tirupati, Vijayawada, Vishakhapatnam, Chittoor, Guntakal, Kakinada, A 01 Apr, 2025

WorkMint Hiring For Banking Operations Manager Job Description

The operations manager role is mainly to implement the right processes and practices across the organiz...
back officeoperationsbackend operationsback office operationsback office processing

Male Front Office - MEHEDIPATNAM, KPHB
AURA HEARING CARE PRIVATE LIMITED 1.00 to 4.00 Years Hyderabad 01 Apr, 2025

To welcome & Assist Customer on their arrival in clinics.

Take down customers details and information. (Forms and official Templates to be filled).

Confir...
cash receiptsms officeinvoice processingbillingpetty cash

Structural Engineer
LEADZN PRIVATE LIMITED 10.00 to 20.00 Years Hyderabad,Zimbabwe, Mozambique, Afghanistan, Bangalore, Noida, Chennai, Gurugram, Kolkata, Pune, Mum 01 Apr, 2025

We are seeking a skilled and experienced structural engineer to join our team and take charge of overseeing our construction projects. Your primary responsibility will be to ensure the safety and...
architecturecommunicationanalyticalengineeringdesignproblemmanagementstructuralsolvingprojectcollaborateability

Staff Transaction Processing
YOUTAG INFOTECH PRIVATE LIMITED 15.00 to 24.00 Years Hyderabad,Kurung Kumey, Bangalore, Tarapur, Kadapa, Cachar, Pune, East Kameng, Itanagar, Other Andam 01 Apr, 2025

Join Accenture and help transform leading organizations and communities around the world. The sheer scale of our capabilities and client engagements and the way we collaborate, operate and delive...
staff retentionstaff assessmentstaff developmentstaff schedulingstaff managementstaff relationsstaff training

Sr IOS Developer
Florican Enterprises Pvt Ltd 7.00 to 12.00 Years Hyderabad 01 Apr, 2025

Dear Candidate , we are hiring Sr IOS developer forb US based IT Company Located at Hyderabad kondapur. if interested then kindly call or drop your resume at hidden_mobil...
cocoainterface buildersvngitswiftobjective cios development

office itor
ASSETCARE SERVICES PRIVATE LIMITED 1.00 to 5.00 Years Hyderabad,Bangalore, Chennai, Kolkata, Gurugram, Chittoor, Faridabad, Chandigarh, Delhi, Ahmedabad 01 Apr, 2025

Janitors work to keep schools, offices, libraries, and hospitals, clean and maintained. They are often asked to work outside normal business hours sometimes early in the morning or late at night ...
adaptabilitycommunication skillsindependencetime managementproblem-solvingphysical stamina

Online Data Entry Operator, Data Entry Clerk, Data Entry Typing, Data Entry
Ruppan India Nidhi Limited 0.00 to 1.00 Years Hyderabad,Bangalore, Noida, Chennai, Gurugram, Kolkata, Pune, Mumbai City, Delhi, Patna 01 Apr, 2025

Freshers and Experienced both can apply for this jobs. Position- Data Entry Executive, Computer Operator, Typist. Back Office Executive Location: Work From Hom...
online work from homedata entry typingonline data entrywork from homepart timedata entry

Part Time Computer , Back Office Executive, Typist, Typing, Online Data Entry
Ruppan India Nidhi Limited 0.00 to 1.00 Years Hyderabad,Bangalore, Noida, Chennai, Gurugram, Kolkata, Pune, Mumbai City, Delhi, Patna 01 Apr, 2025

We are offering a Job. Data Entry Operator, Computer Operator, Back Office Executive, Typist Freshers and Experienced both can apply for this jobs. Position- Data Entry Executi...
part timeback officeonline work from homedata entry typinghome based data entrywork from homedata entryonline data entrydata entryin

Hospital Manager
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 13.00 to 18.00 Years Hyderabad,Bangalore, Kochi, Chennai, Gurugram, Kolkata, Kollam, Thiruvanananthapuram, Mumbai City, D 01 Apr, 2025

We are looking for an experienced Hospital Administration Manager to run our medical facility. To be successful in this role, you should have a deep understanding of all administrative hospital ...
problemmanagementbudgetingassurancecollaborationcommunicationqualityfinancialsolving

Part Time , Data Entry , Online Typing , Home Based , Work From Home
Ruppan India Nidhi Limited 0.00 to 1.00 Years Gwalior,Jabalpur, Kurnool, Jodhpur, Vapi, Kota, Vijayawada, Thrissur, Ambala, Cuddalore 01 Apr, 2025

We are offering a Job. Part Time Jobs, Data Entry Work, Online Computer Work, Work From Home, Back Office Executive, Typist, Online Typing Jobs Freshers and Experienced both can apply for this j...
data entry typingpart timework from homeback officeonline data entrydata entrycontent writingcomputer operatingonline work from home

Requirement in Agency Development manager for Life Insurance CTc upto 5.5 lacs
ATS Infovision 3.00 to 8.00 Years Gwalior,Bhopal, Jabalpur, Solapur, Rajkot, Pune, Aurangabad, Surat, Nagpur 01 Apr, 2025

Dear Candidates, Greetings of the day! Candidate Qualifications:

Previous Sales Experience: Proven success in a sales role, prefe...
agency developmentagent recruitmentunit manager

Back Office Coordinator
Aspect Solution 0.00 to 1.00 Years Gwalior,Jhansi, Bangalore, Madurai, Chennai, Other Odisha, Nizamabad, Basti, Kohima, Tiruppur 01 Apr, 2025

We are hiring for various positions at a leading online platform dedicated to providing part-time job opportunities for freshers. skills needed:Can...
exceltypingdata entry

Operations Manager
WorkMint 0.00 to 4.00 Years Gwalior,Indore, Bhopal, Mandideep, Pithampur, Rewa, Dewas, Chhindwara, Singrauli, Balaghat 01 Apr, 2025

WorkMint Hiring For Banking Operations Manager Job Description Provide day to day planning and tracking support to field operations to ensure efficient and effective operations. 2. Del...
back office operationsbackend operationsback office management

Urgent Hiring for Field sales executive for Hyderabad, Prayagraj , Visakhap
Jobs Territory 1.00 to 4.00 Years Gwalior,Ongole, Tirupati, Hyderabad, Other Andhra Pradesh, Vijayawada, Vishakhapatnam 01 Apr, 2025

Sr. Solar Sales Specialist Roles and responsibilities: Responsible for meeting Monthly Sales targets of Solar PV systems for Residential clients. Lead Generation - Ensure that all marketing le...
solar energysalesfield sales

Data Entry Operator
Fast Recruitment Services 1.00 to 0.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 01 Apr, 2025

Hello Dear applicant. Make your dreams come true with Online Form Filling Data Entry brings an online work opportunity. skill: Basic typing speed or good typing speed Job Position: Computer O...
back officedata entry

Customer Support Specialist
Team Vertex India Global Services Private Limited Hiring For Vertex Global Services 0.00 to 2.00 Years Gurugram,Delhi, Kolkata 01 Apr, 2025

We are looking for skilled Regional Language Support Specialists proficient in Bengali, English and Hindi to join our team. If you have experience handling customer support throu...
bengalicustomer service

Cluster Head - ADRV Insurance Team Handling Profile Salary Upto 14Lac
Niyukti Management Consultants 10.00 to 17.00 Years Gurugram,Delhi, Noida, Lucknow, Pune, Mumbai City 01 Apr, 2025

We are currently hiring for a key position and would like to share the updated requirements with you. Kindly review the details below: Key Specifications:
insurance agency managementinsurance saleslocation headterritory managerbranch headbranch managerchief branch managerarea manager

Required Tele Caller Dayshift
Sharda Consultancy Services 0.00 to 2.00 Years Gurugram,Delhi, Noida 01 Apr, 2025

Required Female Tele Caller for outbound domestic process.Good communication skills Salary - upto 15k working days - 6 days (Sunday off ) Shift Time - 10 AM to 7 pm Salary date...
outbound marketingdomestic bpotelesalesbposales

Urgent | Hiring for Admission Head for Corporate Pre school at Gurugram
HR Globe Recruitment Service 3.00 to 8.00 Years Gurugram 01 Apr, 2025

Dear Candidates, Urgent | Hiring for Admission Head for Corporate Pre school at Gurugram Salary upto 55k Interested candidates please call hr on hidden_mobile 1. Me...
parent communicationcounsellinglead generationpreschoolonline lead generation

Data Entry from home - No Experience Needed
VRD INFOTECH 0.00 to 1.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City, Bhopal 01 Apr, 2025

Dear candidate, We are seeking a meticulous Data Typing Specialist to join our team. Skills Needed: Basic computer knowledge Work Conditions: No age bar, no work pressure, no targets. Both ma...
data entryexcelback office

Data Entry Executive Work For Freshers,Part time work
VRD INFOTECH 0.00 to 1.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City, Bhopal 01 Apr, 2025

Dear Job applicant, It is one of the easiest part-time online jobs for candidates Position: Fresher /Computer Operator/ Data Entry Operator / backed office executive skills needed: basic compu...
exceltypingdata entry

Freelance Recruiter and Intern
KKD Consulting Hiring For KKD 0.00 to 1.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida, Sonipat, Palwal, Mumbai City, Meerut 01 Apr, 2025

Job Title: Freelance Recruiter & Recruitment Intern Location: Remote Job Type: Freelance / Internship
About Us:
[Y...
callingscreening

Sr HRBP Associate -Gurugram
MEGMA SERVICES 3.00 to 6.00 Years Gurugram 01 Apr, 2025

Leading engineering and construction company requires Sr HRBP Associate - Gurugram One of our client luxury brand which is Indias leading manufacturer of premium doors, windows, wood house and t...
hr operationshrbpassociate

Manager Hrd
Employee deal consultants Hiring For A Reputed Readymade Garment Export House 15.00 to 25.00 Years Gurugram 01 Apr, 2025

A reputed garment export House is looking for a HR Head. The company has 3 units in Gurugram . HR Officers in all units will be gradualy reporting to him. The opening is based in Head Office and ...
hr compliancelabour lawshr generalist activitieslabour welfare

Quantity Surveyor
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 14.00 to 24.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City, Guwahati 01 Apr, 2025

Also known as cost consultants, quantity surveyors ensure building projects remain within budget. They provide cost and material estimates, draw up projected budgets, and work alongside a team, ...
quality managementquantity analysisquantity surveyingquality assurancequantity estimationquality control

Hiring For Online Marketing Executive (Work From Home Or Office Both) DELHI-NCR
Desnor Destination Pvt Ltd 0.00 to 4.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida 01 Apr, 2025

Dear Candidate Greetings fromDesnor Destination Pvt Ltd ! Job Summary Idealises Internet Marketing Agency is looking for Marketing Executive to join our dynamic team and embark on a rewarding...
marketing planningdigitaldisplay advertisingmarketingfreelancingwork from homemarketing communicationpart time

Head Admin
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 5.00 to 10.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Pune, Mumbai City 01 Apr, 2025

Main Responsibilities:

Strategic Planning:

Identify opportunities for operational efficiency and cost savings within the administrative functions.

Prepare an...
administration managementoffice operationstravel deskfacility managementfacility operationscorporate administration

Angular Developer
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 2.00 to 7.00 Years Gurugram,Delhi, Bangalore, Chennai, Hyderabad 01 Apr, 2025

1- Strong knowledge and hands-on development experience in Angular 6 & above is a must. 2- Proficient with web technologies - HTML5, CSS3, JSON and writing cross-browser...
gittesting debuggingangular developmentangular clirxjsresponsive design

Business Development Manager
ADITYA BIRLA SUN LIFE INSURANCE COMPANY LIMITED 1.00 to 2.00 Years Gurugram,Delhi, Faridabad, Ghaziabad 01 Apr, 2025

Designation:Agency Manager Education:Any Graduates Experience:Fresher with Good network / Min. 1 Yearin anyDomain Sal...
salesinsuranceagency channelbfsi sales

Data Entry Operator-Work From Home-Computer Work-Typing Work Fresher (Delhi-NCR)
Desnor Destination Pvt Ltd 0.00 to 4.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida 01 Apr, 2025

Dear Candidates, were seeking a skilled data entry operator to join our data team. In this role, youll manage essential data input tasks, such as ensuring data accura...
work from homeback officefreelancingdata entrypart timehome based data entrytypingstudentsfresher

Hiring AR Caller
Starworth Global Solutions 1.00 to 5.00 Years Gurugram,Noida, Jaipur, Chennai, Pune, Mumbai City 01 Apr, 2025

Hiring AR Caller Location:Pune,Mohali,jaipur,Noida,Gurgaon,Chennai,Trichy Work from office night shift Exp;1-5 years Ctc:max 5.5lpa All Documents must PF Mandatory Immediate Joiner to 15 ...
denialsphysician billingar calling

office itor
ASSETCARE SERVICES PRIVATE LIMITED 1.00 to 5.00 Years Gurugram,Delhi, Faridabad, Bangalore, Chennai, Hyderabad, Kolkata, Chittoor, Chandigarh, Ahmedabad 01 Apr, 2025

Janitors work to keep schools, offices, libraries, and hospitals, clean and maintained. They are often asked to work outside normal business hours sometimes early in the morning or late at night ...
adaptabilitycommunication skillsindependencetime managementproblem-solvingphysical stamina

NTT DATA Virtual Drive Hedge Fund Gurgaon
NTT DATA INFORMATION PROCESSING SERVICES PRIVATE LIMITED 1.00 to 3.00 Years Gurugram 01 Apr, 2025

NTT DATA is Hiring experienced candidates for Hedge Fund Accounting domain. Location:Gurgaon Sector 48 (Candor Techspace) Work from Office Only Shift ...
reconciliationhedge fundsnav calculationinvestment banking

Online Data Entry Operator, Data Entry Clerk, Data Entry Typing, Data Entry
Ruppan India Nidhi Limited 0.00 to 1.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City, Patna 01 Apr, 2025

Freshers and Experienced both can apply for this jobs. Position- Data Entry Executive, Computer Operator, Typist. Back Office Executive Location: Work From Hom...
online work from homedata entry typingonline data entrywork from homepart timedata entry

Hospital Manager
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 13.00 to 18.00 Years Gurugram,Delhi, Bangalore, Kochi, Chennai, Hyderabad, Kolkata, Kollam, Thiruvanananthapuram, Mumbai 01 Apr, 2025

We are looking for an experienced Hospital Administration Manager to run our medical facility. To be successful in this role, you should have a deep understanding of all administrative hospital ...
problemmanagementbudgetingassurancecollaborationcommunicationqualityfinancialsolving

Online Data Entry Operator, Data Entry Clerk, Data Entry Typing, Data Entry
Ruppan India Nidhi Limited 0.00 to 1.00 Years Kochi,Madurai, Rajkot, Raipur, Faridabad, Jalandhar, Ludhiana, Nagpur, Bhopal, Erode 01 Apr, 2025

Freshers and Experienced both can apply for this jobs. Position- Data Entry Executive, Computer Operator, Typist. Back Office Executive Location: Work From Hom...
online work from homedata entry typingdata entrypart timecontent writingonline data entrywork from home

Online Work From Home, Data Entry Typing , Computer Operator Typist Part Time
Ruppan India Nidhi Limited 0.00 to 1.00 Years Kochi,Madurai, Raipur, Rajkot, Faridabad, Jalandhar, Ludhiana, Nagpur, Bhopal, Erode 01 Apr, 2025

We are offering a Job. Part Time Jobs, Data Entry Work, Online Computer Work, Work From Home, Back Office Executive, Typist Freshers and Experienced both can apply for this jobs. Positi...
part timeonline work from homedata entry typinghome based data entrydata entryonline data entry

Hospital Manager
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 13.00 to 18.00 Years Kochi,Kollam, Thiruvanananthapuram, Bangalore, Chennai, Hyderabad, Gurugram, Kolkata, Mumbai City, D 01 Apr, 2025

We are looking for an experienced Hospital Administration Manager to run our medical facility. To be successful in this role, you should have a deep understanding of all administrative hospital ...
problemmanagementbudgetingassurancecollaborationcommunicationqualityfinancialsolving

Data Entry Coordinator work,Back Office work
Pick Bright HR Solution 0.00 to 1.00 Years Ernakulam,Kasargod, Thiruvanananthapuram, Bangalore, Tiruvannamalai, Chennai, Hyderabad, Mysore, Oth 01 Apr, 2025

Dear candidate, A simple side job that takes 2 to 3 hours a day. Desired skills and qualities:Basic Computer Knowledge. Laptop/Desktop & Smartphone are required. Training will be provided by ...
backendenglish writingdata entry

Coordinator Backend office work, Home based work
Divine HR Services 0.00 to 1.00 Years Ernakulam,Bangalore, Madurai, Chennai, Hyderabad, Other Madhya Pradesh, Kanyakumari, Pondicherry, Th 01 Apr, 2025

Job Description Dear candidate, Home Based Job& Limited Vacancy Apply Now. J P G TO MS-WORD Data Typing work simply data entry job. Our company hiring every month fresher for typingback officeenglish typingenglish writingback office operationspart timedata entrycomputer operating

Operations Manager
WorkMint 0.00 to 4.00 Years Ernakulam,Idukki, Kannur, Kochi, Kottayam, Malappuram, Palakkad, Pathanamthitta, Thrissur, Wayanad 01 Apr, 2025

WorkMint Hiring For Banking Operations Manager Job Description Supervise and lead a team of banking professionals, providing guidance and support. Monitor and analyze operational perfo...
back officeoperationsbackend operationsback office operationsback office processing

Need Freelancer - Data Entry Operator - Work At Home, Apply Now
VISHWANATH ENTERPRISES 0.00 to 2.00 Years Ernakulam,Thrissur, Chennai, Hyderabad, Vishakhapatnam, Kolkata, Pune, Chandigarh, Hubli, Bhopal 01 Apr, 2025

Dear candidate, We are looking for freshers and experienced candidates for work from home We are offering a Job Part Time Jobs Data Entry Work Online Computer Work Work From Home Back Office Ex...
typing speeddata entrywriting skillspart time

PREV
NEXT

ms office proficient Job Openings

About Us:

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers