Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
Full Description Security Analyst/ Senior Security Analyst/ Lead Security Analyst Location : Chennai, India Job Titile : Security Analyst/ Senior Security Analyst/ Lead Security Analyst Experience : 2...
soccustomerrelationsciscocomplianceidsopensourcesqlinjectionshellscriptingwebapplicationmonitsecurityanalysisdatabasesecurityngtoolssecuritymonitinginfmationsecurityregulatycomplianAbout Accenture: Accenture Technology powers our clients businesses with innovative technologies established and emerging changing the way their people and customers experience work, life and e...
timemanagementmonititinfrastructuredisasterrecoverycommunicationskillscloudpythonngtoolstechnologyplatfThe Cyber Threat Hunting and Analytics Lead has advanced skills in network / host forensics , malware reverse engineering , and cyber threat hunting. The Lead is responsible for escalated incidents th...
opensourcecybersecuritycustomerservicecontentcreationmonitcontentdevelopmentreverseengineeringthreatintelligencegapidsiocsiemngtoolsdigitalfensicsnetwensicssecuritymoniting
Greeting from Trigent! Overall 8+ years of hands on experience in IT Infrastructure domain, who can work as Sr engineer mindset. Candidate has to work closely with IT team on day to day operations an...
sshmonittcpiptcpnginxdnspkidhcpvmwareredhatlinuxngtoolsExcellent Opportunity with one our MNC for Bangalore Location. Exp - 8+ Yrs. Please find below JD. Overall 8+ years of hands on experience in IT Infrastructure domain, who can work as Sr engineer m...
sshmonittcpiptcpnginxdnspkidhcpvmwareredhatlinuxngtoolsJob DescriptionCloud Operations Manager Exp : 10+ yrs Location : Bangalore This is a great opportunity to become part of PowerSchool s Cloud Operations team. The Cloud Operations team works in a gr...
salesdeliverycustomerrelationsmarketingmanagementsoftwareasaservice3rdpartyrelationshipsnewrelicrootcausekeymetricsservicelevelsmonitissueresolutionngtoolskeffectivelytechnicalsuppo274282BR Engineering Expert- Performance II Job Description Senior Performance Engineer responsible for Reactive performance bottlenect RCAs, load testing, conducting performance analysis, benchmar...
usecasestestcasesloadrunnerapitestingloadtestingprofilingtoolscomputersciencemonitsystemsmanagementngtoolsperfmancetuningperfmancetestingperfmancemetricsautomationframewperDo you crave the creativity and freedom of a startup but the stability of a large, established company Are you seeking the autonomy to take risks, make decisions and drive business success Do you want...
incidentmanagementhttpftpapachewebserversawssslmonitiisdnsngtools
Job Purpose : This is a great opportunity to become part of PowerSchool s Cloud Operations team. The Cloud Operations team works in a growing and fast-paced environment managing the hosting infrastr...
commissioningsafetyinspectiontroubleshootingqualitymssqlnewrelicshellscriptingautomationtoolsmonitoperatingsystemsbatchscriptingsqlperlunixlinuxclouddevopstomcatngtoolsRole Description :Design, build and configure applications to meet business process and application requirements. Must Have Skills :Docker Software Good To Have Skills :Jav...
proofofconceptcertifiedtipstrainerproblemsolvingcomplexsystemsbusinessprocessmonitdesigndevelopmentngtoolsinfmationsystemMedline Industries , Inc. Information Services department is seeking a B2C web ecommerce Systems Analyst to join our E - Commerce technology team. This is an opportunity to be a key part of the team r...
testautomationtoolssqlquerieswebcommercedataanalysisunixscriptingtestautomationcomputerscienceautomationtoolsmonitagilemethodologysoftwaredevelopmentconfigurationmanagementngtoolsfunctiQualcomm IT is seeking an experienced Systems Administrator , Sr to implement and support our global engineering applications.Responsibilities: Supporting end - to - end the infrastructure and the app...
monitglobalengineeringwindowsadministrationawsnasssocpuldapdisklinuxbasicdevopsapachetomcatjenkinsngtoolsperfmancemonitingvendJob Opening for the Devops Engineer in an IT MNC Company for the Mohali location. Designation: Devops Engineer Salary: 4 Lac to 6 Lac Experience: 3-5 year Qualification: Any Graduate ( IT Backgrou...
linuxjenkinsgitmavenautomationdatacenterinfrastructuredatacenteripaddressingmonitsystemadministrationauthenticationsslnexusvmwarepythondevopsgitlabngtoolsmultifactJob Description The individual will be part of a very dynamic Support team responsible for smooth functioning of various monitoring tools used by operations and application teams in consumer portfoli...
problemsolvingmonitissueresolutionproblemmanagementincidentmanagementsassqlmocjavaitilunixchatemailbridgechecksconsoledatabasetemplateplaybookngtoolsPerformance and Capacity planner min 2 years of relevant experience. Ability to design and recommend capacity forecast models. Install and use performance monitoring tools and products (like SAS, MXG,...
monitcapacityplanningsasjclmxgispfjes2sdsfdesignplanningomegamondebuggingmonitdiagnosticsCapacityUtilizationMXGngtoolsperfmancemonitingageingperfmanceAs a DevOps Engineer at Deevita, you will have the opportunity to build scalable infrastructure for a rapidly growing customer base, develop processes for seamless deployments, and build and test tool...
lifecyclesqldatabasecomputersciencemonitreleasemanagementproductdevelopmentcustomerengagementhealthcareindustrysystemadministrationoperationsmanagementinfrastructuredevelopmentscaleupngtoolsAbout Accenture: Accenture Technology powers our clients businesses with innovative technologies established and emerging changing the way their people and customers experience work, life and e...
unixoperatingsystemcomplexsystemsbusinessprocessmonithiveunixsqoopooziengtoolsJob Role:Talend Developer Experinece:6 to 9 Years Job Location:Hyderabad
Fullstack Developer_6 to 9 Years_ Chennai Qualifications Bachelors Degree Job Responsibilities
About Accenture: Accenture Technology powers our clients businesses with innovative technologies established and emerging changing the way their people and customers experience work, life and e...
cloudsecuritysecuritytoolscomplexsystemsbusinessprocessmonitawscloudngtoolsJob Responsibilities Job Role: Talend Developer Experience: 2 to 4 Years Job Location: Hyderabad
Role Description Triaging incidents with emphasis on restoring service to normalcy quickly as well as accurate Root Cause Analysis in Production Environments ( that has complex applications architect...
rootcauseanalysiswebsphereapplicationserverrootcausebuildoutsdatacentershellscriptingmonitchangemanagementapplicationservermigrationprojectsincidentmanagementngtoolsproductionsuppActimize development and support Hyderabad Job Responsibilities Analyze production issues and develop remediation improvement plans Engage with business stakeholders and Technical Teams Vendor Manag...
rootcauseriskmanagementcomputerscienceprojectplanningmonitmanagementprojectmanagementreleasemanagementngtoolsvendateliaisonproductionsuppprojectmonitinginfmationsystemsActimize 9 to 12 years Hyderabad Job Responsibilities Analyze production issues and develop remediation improvement plans Engage with business stakeholders and Technical Teams Vendor Management to f...
rootcauseknowledgebaseriskmanagementcomputerscienceprojectplanningmonitmanagementmanagementprojectmanagementreleasemanagementngtoolsvendseniateliaisonproductionsuppActimize 2 to 4 years Hyderabad Job Responsibilities Analyze production issues and develop remediation improvement plans Engage with business stakeholders and Technical Teams Vendor Management to fi...
rootcauseknowledgebasecomputersciencemonitmanagementreleasemanagementtroubleshootingskillsslaunixsplunktomcattestingngtoolsvendinfmationsystemsvendSupport Analyst Date: Jul 10, 2019 Location: Chennai, IN Nielsen NIELSEN CONNECT TECHNOLOGY SUPPORT SPECIALIST Think about the billions of purchases that consumers make every single day around ...
unixtroubleshootingcustomerrelationsslaenvironmentrootcauseanalysisbigdatarootcausesmoketestingknowledgebasecomputersciencedatawarehousingmonitproblemmanagementngtoolstechnicalsuppAbout Accenture: Accenture Technology powers our clients businesses with innovative technologies established and emerging changing the way their people and customers experience work, life and e...
timemanagementmonititinfrastructuredisasterrecoverycommunicationskillscloudpythonngtoolstechnologyplatfAbout Accenture: Accenture Technology powers our clients businesses with innovative technologies established and emerging changing the way their people and customers experience work, life and e...
timemanagementmonititinfrastructuredisasterrecoverycommunicationskillscloudpythonngtoolstechnologyplatfAbout Accenture: Accenture Technology powers our clients businesses with innovative technologies established and emerging changing the way their people and customers experience work, life and e...
timemanagementmonititinfrastructuredisasterrecoverycommunicationskillscloudpythonngtoolstechnologyplatfAbout Accenture: Accenture Technology powers our clients businesses with innovative technologies established and emerging changing the way their people and customers experience work, life and e...
problemsolvingtimemanagementmonititinfrastructuredisasterrecoverycommunicationskillscloudpythonngtoolstechnologyplatfMongo DB_Hyderabad Location Yrs of Ex-4+Yrs Kindly apply local candidates only, those who can attend F2F interview on Saturday, 20th July at Hyderabad. Skill: Mongo DB cluster administration and Dat...
rootcauseanalysissegregationofdutiesrootcausehealthcheckusermanagementmonithighavailabilitycapacitymanagementdatabasemanagementcommunicationskillsngtoolsperfmancetuningAbout Accenture: Accenture Technology powers our clients businesses with innovative technologies established and emerging changing the way their people and customers experience work, life and e...
hybridcloudcomplexsystemsmonitcommunicationskillsarchitecturaldesignlinuxclouddesigndevopsngtoolstechnologyplatfAbout Accenture: Accenture Technology powers our clients businesses with innovative technologies established and emerging changing the way their people and customers experience work, life and e...
teammanagementskillswebservicesteammanagementmonitanalyticalskillsmanagementskillsngtoolstechnologyplatfAbout Accenture: Accenture Technology powers our clients businesses with innovative technologies established and emerging changing the way their people and customers experience work, life and e...
timemanagementmonititinfrastructuredisasterrecoverycommunicationskillscloudpythonngtoolstechnologyplatfAs a member of our Software Engineering Group you will dive head-first into creating innovative solutions that advance businesses and careers. You ll join an inspiring and curious team of technologist...
javasqljavascriptsqlserverjquerybigdatamachinelearningmonitbusinessanalysisfinancialservicescareerdevelopmentelectronicpaymentssoftwareengineeringapplicationprogrammingangularjsngtoolsAbout Accenture: Accenture Technology powers our clients businesses with innovative technologies established and emerging changing the way their people and customers experience work, life and e...
timemanagementmonititinfrastructuredisasterrecoverycommunicationskillscloudpythonngtoolstechnologyplatfAbout Accenture: Accenture Technology powers our clients businesses with innovative technologies established and emerging changing the way their people and customers experience work, life and e...
timemanagementmonititinfrastructuredisasterrecoverycommunicationskillscloudpythonngtoolstechnologyplatfAbout Accenture: Accenture Technology powers our clients businesses with innovative technologies established and emerging changing the way their people and customers experience work, life and e...
timemanagementbatchprocessingmonitqueuemanagementchangemanagementreleasemanagementngtoolseventmonitingAbout Accenture: Accenture Technology powers our clients businesses with innovative technologies established and emerging changing the way their people and customers experience work, life and e...
timemanagementmonititinfrastructuredisasterrecoverycommunicationskillscloudpythonngtoolstechnologyplatfAbout Accenture: Accenture Technology powers our clients businesses with innovative technologies established and emerging changing the way their people and customers experience work, life and e...
timemanagementmonititinfrastructuredisasterrecoverycommunicationskillscloudpythonngtoolstechnologyplatfAbout Accenture: Accenture Technology powers our clients businesses with innovative technologies established and emerging changing the way their people and customers experience work, life and e...
timemanagementmonititinfrastructuredisasterrecoverycommunicationskillscloudpythonngtoolstechnologyplatfJob Description Would you like to be a part of the organization where high energy meets intellectIf you get excited by solving puzzles and working in a collaborative environment, then Aptean wants to ...
totalcostofownershipmssqlserversqlserverclientserverlatinamericaproblemsolvingmonitequipmentsupplymissioncriticalincidenthandlingbusinesssolutionsenterprisesoftwarengtoolscommunicatioAccenture Technology powers our clients businesses with innovative technologies established and emerging changing the way their people and customers experience work, life and entertainment. Join Accen...
tidalenterpriseschedulercontactcentercomplexsystemsmonitservicemanagementunixngtoolskloadautomationtechnologyplatfAbout Accenture: Accenture Technology powers our clients businesses with innovative technologies established and emerging changing the way their people and customers experience work, life and e...
teammanagementskillswebservicesteammanagementcomplexsystemsbusinessprocessmonitanalyticalskillsmanagementskillsacceptancetestingsoftwareengineeringngtoolstechnologyplatfAbout Accenture: Accenture Technology powers our clients businesses with innovative technologies established and emerging changing the way their people and customers experience work, life and e...
monitdisasterrecoverycommunicationskillsawsgitunixrubycloudazurepythondesigndevopsngtoolstechnologyplatfWork directly with the DevOps team and Senior DevOps manager to test system integrity Design and implement build, deployment, and configuration management Test implemented designs Build and test auto...
javasqljavascriptsqlserverjquerysoftwaredevelopmentlifecycletestautomationtoolslifecycletestautomationautomationtoolsmonitsoftwaredevelopmentcommunicationskillscontinuousintegrationngtoolsAn expert with 6-7 Years of experience in Network Performance Monitoring (NPM) using tools such as SolarWinds. Enabling organization to quickly detect, diagnose, and resolve Network performance issues...
sapcustomerrelationsdeliverysalessqlstandardoperatingproceduresoperationsprocessimprovementrootcausesecuritysystemsmonitprocessimprovementngtoolsnetwkmanagementnetwkperfmanceperfmance© 2019 Hireejobs All Rights Reserved