Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
We are looking for Iphone/ Ipad application development for the india development center of a leading MNC in the business intelligence space and providers a good opportunity for working on cutting edg...
java spring j2ee hibernate eclipse iossdk primaryskills secondaryskills interfacebuilder businessintelligence applicationdevelopment ui gl ios sdk edge graphics eanimation mobileplatf msPHP SSE/ Team Lead Looking for prospective PHP SSE/ Team Lead with an experience of 4- 5+ years. The primary skills that the candidate must possess includes PHP/ MySQL, JavaScript, Zend/ Yii framework...
primaryskills angularjs php css yii rest mysql robot drupal search magento phonegap javascript angular CodeIgniter Laravel Symfony Yii CakePHP endFramewDesirable candidate should have knowledge of dot net 4.0, C#, jQuery, Javascript, basic knowledge of HTML/ DHTML, SQL Server 2008/ oracle (pl/ sql) , SSRS and SSIS basic knowledge, Basic knowledge of ...
jquery net html javascript svisio sqlserverreportingservicesssrs sqlserver2012 sqlserver sqlserverintegrationservicesssis sqlserverreportingservices sqlserverintegrationservices primaryskillsTest Source Data extraction, business transformation logic and target table loading Writing SQL queries for various scenarios (Count test, primary key test, duplicate test, default check, technical da...
oracle testing etl sql tltesting sqlqueries primaryskills dataextractionDesignation: HR Manager Required Qualification : MBA- HR Male/ Female : Female Age Limit : Below 40 years Other Benefits : PF Travel or any other details : yes Two Wheeler Required : yes Industry Pref...
recruitment humanresources recruiting induction payroll primaryskills printbrokering employeeengagement softwaredevelopment hr it cv resume imaging hardware software benefits engagement australasia nf
Location :- Sattadhar Char Rasta , Ahmedabad
Male/ Female both can apply .
Required Primary Skills :
We are currently looking for full- time, skilled and artistically creative web site development, graphic design and flash animation professionals. If you have an impressive portfolio and have designed...
pagelayout primaryskills graphicdesign flashanimation contentcreation sitedevelopment technicalcompetence macromediadreamweaver php max css art ids html logo adobe flash design dobeillustratf msWe are currently looking for full- time, skilled and artistically creative web site development, graphic design and flash animation professionals. If you have an impressive portfolio and have designed...
graphicdesign advertising design marketing customerrelations pagelayout primaryskills flashanimation contentcreation sitedevelopment technicalcompetence macromediadreamweaver php max css dobeillustrat
Purpose of Role:
Reviewing alerts generated in Automated transaction monitoring tool on a day-to-day basis as allocated using internal and external research tools and determining suspi...
teamskills musicmaking primaryskills problemsolving secondaryskills analyticalskills transactionmonitoring less writing research pressure reporting numerical monitoring analytical ntimoneylaundering structureExperience Required: 4-8 years Notice Period: 30-45 days Please find the JD below for reference: Should have the ability to provide solutions to any technology related challenges that will be faced...
java mysql jsp hibernate spring webservices applicationprogramming automatedtesting sql api j2ee banking testing software estingtools primaryskills secondaryskills salary polymer
&
Purpose of Role:
Manage a team of AML transaction monitoring analysts ad oversee the alerts worked by them. Performing QA on the alerts worked and providing training to the analysts...
UFT+ VB scripting at Sahasya Global Solutions Pvt. Ltd. (2 Opening) Work Experience: 5.0 Year(s) To 8.0 Year(s) Hi Raghu, We are looking for the candidates who can join us Immediate or Max 10 Days...
sql environment java usinessconsulting primaryskills seleniumtesting itservices testdesign testautomation behavioraltraining technologyser customerrelations functionaltesting sqlserver secondaryskillsPlease share cvs for Application/ Production Support for Hyderabad with 6 to 10Years experience Notice Period: Immediate to 30 days only Primary Skills (Mandatory) : Very Good experience on writin...
unixshellscripting scheduling shellscripting sql cvs net unix tservices primaryskills secondaryskills schedulingtools productionsupp windowsautomation applicationsupp kloadautomation itUFT+Selenium at Sahasya Global Solutions Pvt. Ltd. (2 Opening) Work Experience: 5.0 Year(s) To 8.0 Year(s) Hi Raghu, We are looking for the candidates who can join us Immediate or Max 10 Days. Pleas...
java environment sql estautomation customerrelations businessconsulting itservices primaryskills behavioraltraining seleniumtesting technologyser functionaltesting sqlserver testdesign secondaryskillsASP.Net Developer ASP.Net Developer - Lauren Recaptcha requires verification. Im not a robot ASP.Net Developer Building Restful Json APIs using WCF Knowledge of building ASP.Net Web applicati...
sqlserver primaryskills webapplication secondaryskills sql wcf json robot sqlite SQLServerIntegrationServices WindowsCommunicationFoundation spnet TransactSQL SQLServerRep tingServices LanguageIntJob Description Candidates must have Primary Skills of : HTML-CSS-JS Should be skilled in : Site Development - HTML Additional Skills which would be good to have are: Object oriented JavaScript, ...
jquery css javascript html bootstrap webdevelopment css3 WebStandards W3C rontend primaryskills sitedevelopment html5 BackEndWebDevelopment CrossbrowserCompatibility FrontendDesign FrontendCoding MicrDesirable candidate should have knowledge of dot net 4.0, C#, jQuery, Javascript, basic knowledge of HTML/ DHTML, SQL Server 2008/ oracle (pl/ sql) , SSRS and SSIS basic knowledge, Basic knowledge of ...
jquery net html javascript svisio sqlserverreportingservicesssrs sqlserver2012 sqlserver sqlserverintegrationservicesssis sqlserverreportingservices sqlserverintegrationservices primaryskillsRole : Permanent Position Skill Set : Windows & Backup Admin Experience : 6 to 9 Years Work/Interview Location : Chennai Shift Timings : 04.00 PM to 1.00 AM (IST) Note : If you are interested,...
datadomain primaryskills applicationprogramming it aws emc set iron cloud boost windows software commvault RecoverPoint Celerra ADIC EMCTA EMCIE ACSLS endRole : Permanent Position Skill Set : Windows & Backup Admin Experience : 6 to 9 Years Work/Interview Location : Chennai Shift Timings : 04.00 PM to 1.00 AM (IST) Note : If you are interested,...
datadomain primaryskills exchangeserver serveradministration it aws emc set esxi iron cloud boost vmware windows software exchange commvault administration etw kadministration vend3+ years of experience in automation testing using QTP Primary skills Extensive knowledge and experience in QTP. Ability to design automation framework. Ability to write/ execute/ maintain QTP test ...
testcasesregressiontestingautomationjavalifecycletestsuitesprimaryskillstestautomationsecondaryskillsanalyticalskillsautomationtestingtestmethodologiessoftwaredevelopmenttingdesignau5+ years of experience in software testing Primary skills Good experience in Testing, especially with a GUI Automation tools (QTP/ WinRunner/ Silk Test). Comprehensive experience of the entire Testi...
testcasesregressiontestingautomationjavasilktestlifecycletestsuitesprimaryskillstestautomationsoftwaretestingautomationtoolssecondaryskillsanalyticalskillstestmethodologiestingPosition - RPA developer / RPA Process Designer Location - Bangalore Experience - 3 - 5years Required skills At least 2 to 4 years of professional experience in program...
autocaddraftingpipingpfdidsleansixsigmastronganalyticalskillssixsigmaprocessdesignprimaryskillsproblemsolvingprocessanalysissecondaryskillsanalyticalskillsrelationaldatabasesechnicalreqPosition - Trainee Software Engineer Location - Bangalore Type - Frehsres Qualification - Any Engineers graduates / postgraduates with Java certified course or academic projects...
javahtmlcssmysqljavascriptunittestingprimaryskillssecondaryskillsoopsscrumtestingsoftwareengineersanalyticalaggregatescommunicationServletsSwingsJavaDatabaseConnectivityjavaSoftware Engineer Software Engineer Hands on experience in Java/J2EE ,EJB, Spring 2.0/2.5 ,Hibernate 3.0 framework (All of these are Mandatory) Good hands on with SQL queries Knowledge on Appli...
javasqljavascriptsqlserverjqueryweblogicsqlqueriesprimaryskillsapplicationserverejbsdlcspringtomcatspherebankingcontrolsoftwarehibernatedocumentationavaNamingDirectyInterfaceSoftware Development September 4, 2017 Senior Java Developer - Envision Senior Java Developer Senior Java Developer Domain Skill :Product development experience in Java. Port knowledge is first cons...
javaspringj2eehibernateeclipseprimaryskillsdesignpatternsleadershipskillssoftwaredevelopmenttechnicaldocumentationoptimizationstrategiesxmljspantjpaajaxdojodesignjqueryjavaSoftware Development September 4, 2017 Senior Java Developer - Envision Senior Java Developer Senior Java Developer Domain Skill :Product development experience in Java. Port knowledge is first cons...
javaspringj2eehibernateeclipseprimaryskillsdesignpatternsleadershipskillssoftwaredevelopmenttechnicaldocumentationoptimizationstrategiesxmljspantajaxdesignjqueryethicstestingjava1. Network Engineers (Job Code : J001) Primary Skills Wireless TCP/ IP Bridging / Switching Concepts Routing Concepts Firewall Skill Description Graduate in any discipline with very good Voice Com...
troubleshootingswitchesroutersciscoprimaryskillscustomerhandlingccnaccieccnpacssemailsalaryroutingwirelessfirewallbridgingmatchingswitchingetwkingYou have more than 8 years experience architecting, leading and delivering enterprise- class solutions. You will provide mentorship and leadership to members of our awesome tech team, and get to work ...
javadeliverysitesqlserverobjectwebservicesprimaryskillsdatastructuresproblemsolvingdesignpatternscomputerscienceservicemanagementsoftwareengineersramewienteddesignnetwksecurityEssential Skills Required: - Should have experience in primary skills mentioned. Experience of object oriented programming is essential. Experience of the full software development life cycle from ...
sqlserverjavascriptjqueryhtmlsqlsoftwaredevelopmentlifecyclerootcauseanalysisobjectlifecyclerootcauseprimaryskillssystemsanalysissoftwaredevelopmentcommunicationskillsentedprogrammingEssential Skills Required: - Should have experience in primary skills mentioned. Experience of object oriented programming is essential. Experience of the full software development life cycle from...
sqlserverjavascriptjqueryhtmlsqlsoftwaredevelopmentlifecyclerootcauseanalysisobjectlifecyclerootcausespringbootprimaryskillssystemsanalysissoftwaredevelopmententedprogrammingcommunicatWe are looking for Iphone/ Ipad application development for the india development center of a leading MNC in the business intelligence space and providers a good opportunity for working on cutting edg...
javaspringj2eehibernateeclipseiossdkprimaryskillssecondaryskillsinterfacebuilderbusinessintelligenceapplicationdevelopmentiossdkedgegraphicseanimationmobileplatf"
Dear Candidate, We have openings for Sql Developer for our Banking Client, the JD is: Minimum 6 month exp. Sal upto 20k ctc. Primary Skills : MSSQL, SSIS, Performance Tuning, Data modeling. JD &...
sqlsqlserverssisssrsdatabaseadministrationdatamodelingprimaryskillscommercialmodelsetldesignbankingopeningsedproceduresperfmancetuningperfmanceTransactSQLSQLServerReptingServicesClient of Forstaffing Noida, India Full -time Jul, 18 Symbian Developer Forstaffing Symbian Developer September 15, 2016 Filed under: Published: July 18, 2011 Noida, India Job Type Description Desi...
javasqljavascriptsqlserverjquerymobileapplicationsapidesignmobilesymbiansoftwareeducationobiledesignprimaryskillseducationalqualification24x7emailbusinessfacebookASP.Net Developer ASP.Net Developer - Lauren Recaptcha requires verification. Im not a robot ASP.Net Developer Building Restful Json APIs using WCF Knowledge of building ASP.Net Web applicati...
sqlserverprimaryskillswebapplicationsecondaryskillssqlwcfjsonrobotsqliteSQLServerIntegrationServicesWindowsCommunicationFoundationspnetTransactSQLSQLServerReptingServicesLanguageIntWe would like to introduce ourselves as Recruitment Services Leading Recruitment Organization with more than 35 Blue Chip Companies of India. We are having WALK-IN INTERVIEW For Network/Radio Jobs Fo...
salesrlfilteringinfosecroutingprotocolsprimaryskillsnetworkplanningsymantecendpointprotectionnetworkperformancemanagementciscoasaoperationsmanagementprojectmanagementsecurityauditsbordercontrolnetworkengineeringWe would like to introduce ourselves as Recruitment Services Leading Recruitment Organization with more than 35 Blue Chip Companies of India. We are having WALK-IN INTERVIEW For Network/Radio Jobs Fo...
salesrlfilteringinfosecroutingprotocolsprimaryskillsnetworkplanningsymantecendpointprotectionnetworkperformancemanagementciscoasaoperationsmanagementprojectmanagementsecurityauditsbordercontrolnetworkengineeringCustomer Focused Technical Support ( CFTS) Juniper Networks Customer Focused Technical Support Services provide Customer with access to a designated team of senior engineers with extensive experien...
troubleshootinglanoperatingsystemsnewproductdevelopmentlayer3iproutingcustomerfocusprimaryskillsknowledgebasecomputerscienceroutingprotocolsetwkingtechnicalsuppnetwktopologycustomPosition: Technical Support Engineer 3 - Routing Location: Bangalore Customer Focused Technical Support ( CFTS) Juniper Networks Customer Focused Technical Support Services provide Customer wi...
troubleshootinglanoperatingsystemsnewproductdevelopmentlayer3iproutingcustomerfocusprimaryskillsknowledgebasecomputerscienceroutingprotocolsetwkingtechnicalsuppnetwktopologycustomI. Job Summary: Looking for candidates having 9 Years of total experience in software development in a Java / J2EE environment II. Roles & Responsibilities: Core Responsibilities: Primarily respon...
javasqlpringbootsupplychainteamhandlingprimaryskillsstronginterpersonalskillsfrontendwebapplicationdesignpatternssqlserverI.Job Summary: Looking for candidates having 12 Years of experience in Full stack II.Roles & Responsibilities: Core Responsibilities: Primarily responsible to tech architect , mentor and guide th...
javadeliverynetframeworkpringbootdesignpatternswebapplicationsqlserverprimaryskillsfrontendsupplychaintimemanagement
Design and develop responsive web portal both ui and functionality development. Should be well versed with AngularJS, Javascript and JQuery along with HTML5 and CSS3. Primary skills : HTML5 and Ang...
angularjsrestcss3sqlangularmysqljqueryjavascriptcsshtml5guihtmlportalontextualinquirycardsortingheuristicevaluationmobiledesignprimaryskillsuserscenariosKey Responsibilities: Logging enquires/requests received from the internal and external customers and reverting with the appropriate resolutions within the stipulated TAT. Follow up with various d...
emailwritingwritingskillsprimaryskillsemailwritingloggingresolutionscommunicationFictionGhostwritingMemoirNovelsBookReviewsFictionWritingChatonfictiontStiesCreativeNonfictionOnlineSuWe have an urgent openings for Software developer Design, develop and deliver functionalities for dynamic web and/or desktop applications on the Microsoft .NET platform. Primary Skills (Must ...
frontendprimaryskillsdesignpatternsagiledevelopmentmicrosoftsqlsqlnetoopsagiledesignbackenddesktopsoftwareopeningsWebStandardsspnetmvcaspnetBackEndWebDevelopmentDesignation - Java cum Hybrid Mobile app Developer Job location: Bangalore Experience : 5-9 yrs CTC : 8Lpa Notice period : Max 15 days Mode of interview : Face to face Role Description: We are l...
softwaredevelopmentlifecyclemobileapplicationdevelopmentlifecycleopensourcewebservicesmusicmakingprimaryskillssearchenginesuserrequirementssoftwarejavanetwksystemsmemymanagement
Role: TAC Engineer Core Routing Business Unit: Juniper Advance TAC Location: Bangalore This position is for the Juniper Advance TAC (Technical Assistance Centre) for their M, T and MX series pro...
troubleshootinglanoperatingsystemsiproutingcomputerscienceetwkingtechnicalsuppnewproductdevelopmentlayer2layer3primaryskillsknowledgebaseroutingprotocolscustomerhandlingproblemresoAbout Business Line GTCB Risk and Control aligns globally to Global Transaction , Custody and Banking which is a part of Global process delivery, team supports Transaction services, Reconciliation (...
insurancequalitysalesmisriskassessmentriskcompliancemanagementprojectmanagementfinancialanalysisustomerrelationsboardofdirectprimaryskillssecondaryskillssenipresentationskillstransactionservicesriskrepTitle Officer / Level 420 Business Line FRFA Work Location Bangalore Process Name Post Trade Investment Compliance Reportees Cost Centre Shifts (in IST) 6:00 PM IST to 3:00 AM IST 7:00 PM IST ...
charteredfinancialanalystvisualbasicmutualfundscompaniesactfinancialrisksharedservicesproblemsolvingtimemanagementclientmanagementusicmakingprimaryskillssecondaryskillsanalyticalskillscodingexperiencefinanc© 2019 Hireejobs All Rights Reserved