Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
Skill: PMO Executive Exp: 3 - 5 Years Below is the JD for the same. Must have skill
Batch Management incidents management willing to learn the banking domain stakeholder management Our Ideal Candidate Java ,Oracle ,unix , team and stakeholder management experience.,...
sales sla delivery stakeholdermanagement unix ideal banking management echnicalsupp customerrelations turn brand acle equality perf mance BenefitsRealisation ProgrammeDelivery PrivateSectMSPPractitioner StakeholderMust have Bike with Dl & Smart Phone. knowledge of Location Tracking. smart & Good Communication Skills. work Will Be On Delivery of Flip-kart & Amazon Products. Salary 1 Lac To 1 Lac 50 Thousand...
communication p3m3 delivery sales clearing accounts dispatch salary management eliverymanagement programmedelivery changeprogrammes projecthealthchecks dependencymanagement programmeassurance programmegovernance1. 5+ years of experience OutSystems - Should have worked on Outsystems Platform Working exposure on SQL. Ability to mentor junior team members. Excellent communications skill. Proactive approach with...
projectdelivery businessprocess library business connect integration ProgrammeDelivery BenefitsRealisation ServiceImprovement MSPPractitioner ProjectGovernance ProgrammeOffice mbuilder repositEnd to end implementation (Deployment setup , configuration ) of CyberArk Privileged Access Management (PAM) solution. Managing cluster environment of CyberArk Vault (CVM) along with DR Site configur...
projectdelivery accessmanagement requirementgathering vault access testing cluster business cyberark management monit implementation ProgrammeDelivery BenefitsRealisation ServiceImprovement MSPPractitioner ng* Bachelor degree or master degree in business or related field. * Proven experience in program management. * Proven stakeholder management skills. * Proven experience managing a team. * Experienc...
delivery projectmanagement customerrelations java stakeholdermanagement microsoftapplications excel business management BenefitsRealisation ProgrammeDelivery MSPPractitioner ep ting PrivateSectStakehoKey duties and responsibilities would be to understand the complete lifecycle of a real estate project from a delivery perspective, interdependencies in project execution, preparing the Base line sche...
marketing sales eventmanagement management advertising projectdelivery projectexecution projectscheduling schedule primavera monit scheduling mobilization ProgrammeDelivery indingopp tunities rep ting ing BenefiCandidates will be responsible for planning for Different Location of Gujarat for best Event. Key duties and responsibilities would be to understand the complete lifecycle of a real estate project fro...
marketing sales eventmanagement management advertising projectdelivery projectexecution projectscheduling planning schedule primavera monit scheduling mobilization ProgrammeDelivery indingopp tunities rep ting ingCandidates will be responsible for planning for Different Location of Gujarat for best Event. Key duties and responsibilities would be to understand the complete lifecycle of a real estate project fro...
marketing sales eventmanagement management advertising projectdelivery projectexecution projectscheduling planning schedule primavera monit scheduling mobilization ProgrammeDelivery indingopp tunities rep ting ingDetailed knowledge of the Indian Power & Regulatory sector, including its commercial, technological and regulatory drivers Minimum 3 years of experience in regulatory domain preferably in a consulti...
projectdelivery managementskills projectmanagement financialmodelling businessdevelopment excel balance business management commercial consulting regulatory analytical agreements ProgrammeDelivery enefitsRealisatioUrgent hiring for BDM (IT Staffing) Min experience 6 yrs into Business Development Excellent comms & PR skills Target oriented Client Management/ Delivery Management Only Males Mail at nishaagarwal@bs...
sales marketing businessdevelopment customerrelations target deliverymanagement behavioraltraining pr bdm mail business management DependencyManagement ProgrammeAssurance ProgrammeDelivery P3M3 rogrammeGovernanJob Description To build product portfolio for an e-commerce company To identify the best suited vendors for the product category To contact the vendors and explain the value proposition To nego...
sales marketing retail sourcing pricing productportfolio brand salary vendor vendors business portfolio commercials ProgrammeDelivery BenefitsRealisation ITTransformation P3O commerce ProjectManagementOfficePMOTo build product portfolio of food category for an e-commerce company To identify the best suited vendors for the product category To contact the vendors and explain the value proposition To negot...
productportfolio businessdevelopment food sales retail salary vendors business marketing portfolio commercials ProgrammeDelivery BenefitsRealisation ITTransformation P3O PM commerce ProjectManagementOfficePMOTo build product portfolio of food category for an e-commerce company To identify the best suited vendors for the product category To contact the vendors and explain the value proposition To negot...
productportfolio businessdevelopment food sales retail salary vendors business marketing portfolio commercials ProgrammeDelivery BenefitsRealisation ITTransformation P3O PM commerce ProjectManagementOfficePMOCategoryHuman Resource Executive Positions1 QualificationMBA Specialization Experience2 to 5 Years Work PlaceBangalore RoleHuman resource management and fulfil satutory complience.,...
recruitment sourcing scheduling screening resourcemanagement management ProjectGovernance EmployeeReferralPrograms ProgrammeDelivery GlobalDelivery StaffAugmentation GlobalResourceManagement tals ResourceAllocEnd to end implementation (Deployment setup , configuration ) of CyberArk Privileged Access Management (PAM) solution. Managing cluster environment of CyberArk Vault (CVM) along with DR Site configur...
projectdelivery accessmanagement requirementgathering vault access testing cluster business cyberark management monit implementation ProgrammeDelivery BenefitsRealisation ServiceImprovement MSPPractitioner ngWe are looking to hire a Housekeeper to join our cleaning team. You will be responsible for cleaning rooms and common areas, disposing of trash, changing beds, and notifying maintenance of any issues....
bedrooms hotel chairs maintenance housekeeping housebuilding headboards iberopticnetworks officecleaning benefitsrealisation programmedelivery housedesign housekeepingofficehelp housekeepingmanagement housecleaning princepractitioner houseKey duties and responsibilities would be to understand the complete lifecycle of a real estate project from a delivery perspective, interdependencies in project execution, preparing the Base line sche...
marketing sales eventmanagement management advertising projectdelivery projectexecution projectscheduling schedule primavera monit scheduling mobilization ProgrammeDelivery indingopp tunities rep ting ing BenefiComplete documentation of the project to support delivery and for future use/reference Report on common sources of technical issues or questions and make recommendations to development team Constantly...
projectdeliverybusinessanalysisbusinessanalysismonitdocumentationProgrammeDeliveryBenefitsRealisationServiceImprovementMSPPractitionerProjectGovernanceProgrammeOfficePRINCE2ecommerceProgramme12. Executive - Billing Resource Location Mumbai Experience 0-3 years Job Description Raising of Invoices / credit Notes on Customers Coordination and followups with Customers Coordination and f...
pmocreditaccountsP3OProgrammeDeliveryPMODesignPMODevelopmentBenefitsRealisationOPM3SmallBusinessLendingConsumerLendingCommercialLendingMOsetupProjectPtfolioManagementITTransfmationTo carry out all kind of controls/inspections like PPM, Inline, Mid, Final audits etc as per AQL system & as defined by the buyer in order to get product in right desired quality within the given deli...
hardgoodshomefurnishingppmaqlbuyingenglishmanagementaccessProgrammeDeliveryProjectManagementOfficeBenefitsRealisationP3OBusinessAlignmentP3M3endiesITTransfmationPMOsetupEnterprisePThe Business Analyst will: Work collaboratively with Country Finance, Treasury, Group Liquidity Regulatory reporting and BAU teams to understand requirements and articulate them within the Business a...
testcaseslifecycleriskmetricsliquidityriskbusinessanalysischangemanagementbusinesssolutionacceptancetestingprogrammedeliverysystemarchitecturetatementsofwksowregulatyreptingReq. Lab Technician in Diagnostic center at Varanasi. Thanks with Regards, RUCHI (HR-Executive ) 9455825430, Abhi Resource Management SRGP MALL, SECTOR- 8 B, 3rd Floor 365 GANGES NAGAR, Near Tulshi Me...
biochemistrymicrobiologyqualitycontrolhematologypathologyresourcemanagementmetalmanagementdiagnosticsProjectGovernanceEmployeeReferralProgramsProgrammeDeliveryGlobalDeliveryStaffAugmentationlobalReCandidate should know how to Write SQl Queries Candidate should be working into analytics, building models on R/Python etc Candidate should have worked on visualization tools Candidate should have ...
agilecustomerrelationsdocumentationdeliveryrequirementsstakeholdermanagementsqlanalyticsmanagementvisualizationBenefitsRealisationProgrammeDeliveryMSPPractitionerStakeholderEngagementrivateSectChby studying the industry trends and customer feedback 2) Innovation: Provide architectural assistance for developing new intellectual properties; 3) Talent Development 1. Conduct regular awarene...
projectdeliverytalentdevelopmentfinancialmanagementsalesvideobrandmanagementenablementcompletionarchitectureintellectualProgrammeDeliveryBenefitsRealisationServiceImprovementMSPPractitionerrojeThe person will be leading and managing a team of cross technology developers and leads. He will be responsible for complete e2e solution of the applications and integrations. He will be the SPOC for ...
stakeholdermanagemente2emanagementrojectadministrationbusvendbusinessownershipenterprisedeliveriesBenefitsRealisationProgrammeDeliveryPrivateSectMSPPractitionerStakeholderEngagementChangeProgrammesCentral© 2019 Hireejobs All Rights Reserved