project accounting jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

project accounting Job Openings

Showing 29201 - 29250 of 37987 Jobs

Internal Auditor

BETTER HIRE 2.00 to 4.00 Years Chennai 01 Apr, 2024

We are looking to hire an internal auditor with brilliant accounting and analytical skills. Internal auditors are expected to be organized with brilliant problem-solving skills and consta...
audit compliancetax auditinternal audittax complianceinternal audit transformation

UHT Operator
MMK ENTERPRISES 5.00 to 10.00 Years Bangalore 01 Apr, 2024

Please find the below job Details: Required UHT Operator Commissioned of UHT Infusion Plant . Responsible to complete UHT production & Filling line project. Installation and commissioning commissioninginstallation

Data Analyst (Power BI, Python, SQL)- Internal Audit domain, Bangalore
Talent Leads HR Solutions Pvt Ltd 3.00 to 8.00 Years Bangalore 01 Apr, 2024

Qualification- Mba Finance / Mca Experience 3 years Location Bangalore BO. 5.5 Days working from Office Key responsib...
sqlpowerdata analysisdatapython

SAP Finance Subject Matter Expert (SME/Module Lead/Solution Architect)
AATRAL TECHNOLOGIES INDIA PRIVATE LIMITED 7.00 to 10.00 Years Bangalore 01 Apr, 2024

Job Title: SAP Finance Subject Matter Expert (SME/Module Lead/Solution Architect) Job Responsibilities:

Work as a SAP Finance Subject Matter Expert ...
sap fico - financial accounting / controllingsap ficofico

Product Owner Busines Analyst
WHITE HORSE MANPOWER CONSULTANCY (P) LTD 6.00 to 11.00 Years Bangalore 01 Apr, 2024

Required Product Owner: 4 years of product owner / business analyst / product management or related experience Business Analysis: 0-3 years of product owner / business analyst / product managem...
use casesdevopsazureagile project managementagile developmenttest case matrixazdo

Maintenance Engineer
KINAL GLOBAL CARE PRIVATE LIMITED 15.00 to 25.00 Years Bangalore 01 Apr, 2024

Job description

bachelors degree in engineering preferably in Mechanical, Electrical or Instrumentation with CGPA 7.0 or above;

Minimum 8 years of experience in oil and ga...
maximoschedulingmaterial managementpackaginghydraulicsinstrumentationorder managementms projectutility maintenance

Maintenance Engineer
KINAL GLOBAL CARE PRIVATE LIMITED 2.00 to 7.00 Years Bangalore 01 Apr, 2024

Job description

bachelors degree in engineering preferably in Mechanical, Electrical or Instrumentation with CGPA 7.0 or above;

Minimum 8 years of experience in oil and ga...
hydraulicsms projectmaximomaterial managementschedulingorder managementpackagingplant maintenanceinstrumentation

Sales Engineer
POST A RESUME 1.00 to 5.00 Years Bangalore 01 Apr, 2024

Qualification: B.E/B.Tech/Diploma in Electrical/Mechanical (Mandatory) Location :Ahmedabad/ Delhi/ Noida/Gurugram/ Andhra Pradesh/Hyderabad/ Telangana/ Bangalor...
saleshvac sales

Event Designer
MILLENNIUM BABYCARES PRIVATE LIMITED 5.00 to 10.00 Years Bangalore 01 Apr, 2024

Have you ever found yourself at a wedding or corporate event where you were awed by the detail put into the decor There is a very good chance an event designer was behind it all. Event designers...
tradetransportationlogisticsmanagementcorporatebudgetaudiovisualbudgetsexternalcommunityeventsgroundshows

Marketing Manager
MILLENNIUM BABYCARES PRIVATE LIMITED 13.00 to 23.00 Years Bangalore 01 Apr, 2024

An Email Marketing Manager utilizes email communication tools to market a company and increase brand awareness. They are experts in the usage of email communications and develop marketing strateg...
marketservicemarketinganalyticscampaignspowerpointcustomerresearchmanagementdigitalprojectntegratedstrong

Facility Engineer
MILLENNIUM BABYCARES PRIVATE LIMITED 5.00 to 10.00 Years Bangalore 01 Apr, 2024

We are looking for a facilities engineer to be responsible for the maintenance and improvement of our manufacturing plant. You will be responsible for assessing the facilitys resource req...
admin facilities managementproduction facilitiesfacility operationsfacilities engineeringfacilitated processfacility managementpublic administrationpublic financefacility administration

Consulting Engineer
MILLENNIUM BABYCARES PRIVATE LIMITED 10.00 to 19.00 Years Bangalore 01 Apr, 2024

A consulting engineer advises clients on the planning, design, and construction of projects. They can be licensed to practice any technical specialty, including but not limited to mechanical, ele...
project managementjenkinsproduct developmentazurejavaemerging technologiesdata analysisvirtualizationlinux

Assistant Site Engineer
M/S LANDCRAFT RECREATIONS PRIVATE LIMITED 5.00 to 10.00 Years Bangalore 01 Apr, 2024

Job description Overall Planning and Execution of work from receipt of BOQ to Site completion delivering Quality on Time and Within Budget. To turn clients decisions in our Favour & making pr...
project controlproject schedulingproject handlingmonitoringsite initiationsite planningboq preparationcivilbusiness process

TELECOM SITE ENGINEER Saudi Arabia
GLOBAL WINGZ CAREERS Hiring For Engineering company 5.00 to 10.00 Years Bangalore 01 Apr, 2024

Job Title TELECOM SITE ENGINEER Industry of the Employer (only in case of job posting) CIVIL CONSTRUCTION / OIL & GAS Number of Vacancies 25 engineering servicestelecom engineeringmechanical engineering

Graphic Designer
EduGATE Engineering Academy 1.00 to 5.00 Years Ahmedabad 01 Apr, 2024

About us: EduGATE Engineering Academy EduGATE Engineering Academy is a leading GATE coaching institute of Gujarat founded by IIT Bombay alumni in 2013. Institute has trained more than 12000 stu...
Graphic DesignVideo ProductionVideo EditingContent CreationInnovation

Electronics Hardware Engineer
Multispan Control Instruments 1.00 to 4.00 Years Ahmedabad 01 Apr, 2024

Job Description We are seeking an experienced Electronics Hardware Engineer to join our team. The ideal candidate will have a strong understanding of electronics hardware design and a passion for...
Electronics hardware designAnalogdigital circuit designPrototype testinganalysisComponent sourcingEmbedded systems firmware programmingDevelopment of production test specificationsPreparation of bills of materialsPCB layout

Corporate Sales Executive in Ahmedabad
BDNT Labs Private Limited 5.00 to 9.00 Years Ahmedabad 01 Apr, 2024

Key Responsibilities Create a network strategy plan to secure an adequate dealer footprint for current and future business including investment request and involve feasibility study Look for new...
Business PlanningProject ManagementDealer ManagementMarket ExpansionNetwork Strategy PlanningFeasibility StudyCustomer Satisfaction ManagementGlobal Team CollaborationFacilities Standardization

Senior Hardware Engineer
Oxit India 7.00 to 11.00 Years Ahmedabad 01 Apr, 2024

Oxit is a pioneering IoT and design service company seeking a Senior Hardware Engineer to enhance our engineering team. This role is essential for client interfacing during technical reviews and d...
Hardware DesignSchematic CaptureLayout DesignAltium DesignerAnalog Circuit DesignDigital Circuit DesignMicrocontrollersPower ManagementBluetoothWiFiZigbeeProject DocumentationIoT TechnologiesRF Communication

Assistant Manager Business Development
Unison Globus 3.00 to 7.00 Years Ahmedabad 01 Apr, 2024

Company Description Unison Globus is a Florida-based company that has been catering to the needs of CPAs, EA, and Accounting professionals in North America, Australia, New Zealand, and Singapore ...
Business DevelopmentSalesClient Relationship ManagementAccount ManagementCommunicationInterpersonal SkillsAnalytical SkillsMicrosoft OfficeProblemSolving SkillsFinancial KnowledgeAccounting KnowledgeTax Preparation Services

Assistant Manager / Deputy Manager - Internal Audit
UpMan Placements 10.00 to 14.00 Years Ahmedabad 01 Apr, 2024

UpMan Placements has an exciting career opportunity with one of our esteemed clients from the Construction industry. Role - Internal Audit Level - Assistant Manager / Deputy Manager Location - ...
Compliance ManagementProject ManagementClient ManagementSite AccountingCostingBudgetingMIS ReviewCost ControlReduction

Office Assistant urgent hiring 10 th pass
Arise HR Services 1.00 to 6.00 Years Vishakhapatnam 30 Mar, 2024

Role Description This is a full-time on-site role for an Investment Banking Analyst located in Delhi, India. The Investment Banking Analyst will be responsible for assisting se...
computer skillsproblem-solving skillsteamwork skills

Cargo Officer
Prime Placement Vision Pvt Ltd 0.00 to 4.00 Years Vishakhapatnam 30 Mar, 2024

A Cargo Officer, also known as a Cargo Agent or Cargo Handler, is responsible for the efficient handling, processing, and transportation of cargo goods within various modes of transportation, suc...
forwardingcargo managementproject cargocargologisticscargo operations

Data Entry Operator, Work From Home, Part Time
LAXMI TECHNOLOGY 1.00 to 5.00 Years Vishakhapatnam 30 Mar, 2024

Greetings, We AreGovt. Reg. AndGenuine Data Entry service provider, In All over India. For more details Contact Our Project Manager90hidden_mobil...
excelfreelance writingwork from home typingdata entry operationfreelance typingmanualfreelance editing

SALES EXECUTIVE CASHIER IN DUBAI
Always International Manpower Service Hiring For Accountant Data Entry Cashier Sales Job in Dubai 1.00 to 5.00 Years Vishakhapatnam 30 Mar, 2024

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Complying with all company,...
salessales processaccountingdocument controldata entrydata analysiscashier activitiescashiersaccount management

Ticketing Counter Staff
SD PLACEMENT 0.00 to 1.00 Years Vishakhapatnam 30 Mar, 2024

We are urgent hiring An Air Ticketing Executive is a professional responsible for handling the process of booking airline tickets for customers. Their primary duties include: Customer Se...
supervisionticket bookingmanagement accountingticket operations

Credit Analyst
BETTER HIRE 0.00 to 3.00 Years Vishakhapatnam 30 Mar, 2024

We are seeking to hire a credit analyst to join our team. You will manage a portfolio of clients and report to the Head of Credit. Your responsibilities will include evaluating the financ...
credit analysislines of creditcredit controlcredit riskcredit appraisalsmall business lending

Hiring For Customer Service Manager
Divya Staffing Solution 0.00 to 4.00 Years Vishakhapatnam 30 Mar, 2024

Our company is searching for a motivated and experienced customer service manager to lead our customer service department. Your goal will be to provide outstanding customer service to our clients...
microsoft wordpowerpointtaxationdata entry

Hiring For Electrical Engineer Fresher or Experience
Divya Staffing Solution 0.00 to 4.00 Years Vishakhapatnam 30 Mar, 2024

We are looking for a skilled mechanical engineer to join our team. You will be responsible for working on all stages of our production cycles, from research and design to manufacturing, installat...
maintenancearchitectureinterior designingtechnician activities

WFH | Data Entry Typing
Fondstaff Private Limited 0.00 to 3.00 Years Vishakhapatnam 30 Mar, 2024

We have an urgent requirement of Data Entry Operator (Work From Home) who is dedicated and serious about his work. We have various types of online and offline project works. Responsibil...
smswork from home typingpart time work from homework from homepart time freelanceback officeonline data entryonline work from homecomputer operator

Work From Home, Data Entry Operator
Learning Planner 0.00 to 2.00 Years Vijayawada 30 Mar, 2024

We have various types of online and offline project works. We have an urgent requirement of Work From Home, Data Entry Operator who is dedicated and serious about his work. Responsibili...
typing speedwork from homedata entry

Hiring For Customer Service Manager
Divya Staffing Solution 0.00 to 4.00 Years Vijayawada 30 Mar, 2024

Our company is searching for a motivated and experienced customer service manager to lead our customer service department. Your goal will be to provide outstanding customer service to our clients...
microsoft wordpowerpointtaxationdata entry

Hiring For Electrical Engineer Fresher or Experience
Divya Staffing Solution 0.00 to 4.00 Years Vijayawada 30 Mar, 2024

We are looking for a skilled mechanical engineer to join our team. You will be responsible for working on all stages of our production cycles, from research and design to manufacturing, installat...
maintenancearchitectureinterior designingtechnician activities

WFH | Data Entry Typing
Fondstaff Private Limited 0.00 to 3.00 Years Vijayawada 30 Mar, 2024

We have an urgent requirement of Data Entry Operator (Work From Home) who is dedicated and serious about his work. We have various types of online and offline project works. Responsibil...
smswork from home typingpart time work from homework from homepart time freelanceback officeonline data entryonline work from homecomputer operator

Cargo Officer
Prime Placement Vision Pvt Ltd 0.00 to 4.00 Years Vijayawada 30 Mar, 2024

A Cargo Officer, also known as a Cargo Agent or Cargo Handler, is responsible for the efficient handling, processing, and transportation of cargo goods within various modes of transportation, suc...
forwardingcargo managementproject cargocargologisticscargo operations

SALES EXECUTIVE CASHIER IN DUBAI
Always International Manpower Service Hiring For Accountant Data Entry Cashier Sales Job in Dubai 1.00 to 5.00 Years Vijayawada 30 Mar, 2024

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Complying with all company,...
salessales processaccountingdocument controldata entrydata analysiscashier activitiescashiersaccount management

Assistant Accountant
BETTER HIRE 0.00 to 3.00 Years Vijayawada 30 Mar, 2024

We are looking for an Accounting Assistant to perform daily accounting tasks that will support our financial team. Accounting Assistant responsibilities include managing...
sapaccountingtally erptallyaccounting entries

Ticketing Counter Staff
SD PLACEMENT 0.00 to 1.00 Years Vijayawada 30 Mar, 2024

We are urgent hiring An Air Ticketing Executive is a professional responsible for handling the process of booking airline tickets for customers. Their primary duties include: Customer Se...
supervisionticket bookingmanagement accountingticket operations

Data Entry Typing (Work From Home )
Learning Planner 0.00 to 1.00 Years Vellore 30 Mar, 2024

We are in urgent need of Data EntryTyping(Work From Home Jobs) who is dedicated and serious about his/her work. We have various types of online and offline project works. Responsibiliti...
typing speeddata entry operationms exceltypingms wordwork from home

Business Analyst Urgent Vacancy
RENUKA INTERPRISES 0.00 to 4.00 Years Vellore 30 Mar, 2024

We are hiring a business analyst to join our project team. You will work alongside other business analysts and report directly to the project manager. Your main tasks will include performing deta...
analysisdata analysissqlbusiness analysis

Hiring For Software Developer
Divya Staffing Solution 0.00 to 4.00 Years Vellore 30 Mar, 2024

Our company is seeking to hire a skilled software developer to help with the development of our current projects. Your duties will primarily revolve around building software by writing code, as w...
pythondatabasesoftware developmentcomputer science

Hiring For Business Analyst
Divya Staffing Solution 0.00 to 4.00 Years Vellore 30 Mar, 2024

We are hiring a business analyst to join our project team. You will work alongside other business analysts and report directly to the project manager. Your main tasks will include performing deta...
project managementbusiness processsoftware testingdata analytics

Business Analyst Opening
Divya Staffing Solution 0.00 to 4.00 Years Vellore 30 Mar, 2024

We are hiring a business analyst to join our project team. You will work alongside other business analysts and report directly to the project manager. Your main tasks will include performing deta...
business processdata analyticssoftware testingproject management

Academic Content Expert - Accountancy (English)
QA solvers 0.00 to 4.00 Years Varanasi 30 Mar, 2024

Key Responsibilities Working on digital projects meant to cater to the K-20 segment Reviewing/Creating text and video content in English Providing quality content for 11-12th and higher educati...
AccountancyEnglish

Assistant Manager
Contrywide 3.00 to 5.00 Years Varanasi 30 Mar, 2024

Company Description We suggest you enter details here. Role Description This is a full-time on-site role for an Assistant Manager located in Varanasi. The Assistant Manager will be responsible ...
CommunicationInterpersonal skillsCritical thinkingMicrosoft OfficeProject managementTeam managementCollaborationStrong leadershipProblemsolvingDecisionmakingOrganizational skills

ore Sr Executive Assistant Manager Manager
The Bull Events 3.00 to 7.00 Years Varanasi 30 Mar, 2024

Company Description The Bull Events is a modern events management and experiences company based in Varanasi, Uttar Pradesh, India with a decade of experience in executing large scale meetings, te...
Project ManagementCommunicationInterpersonal SkillsEvent PlanningExecutionTeamworkCollaborationGraphic DesignOrganizational SkillsProblemSolvingDecor

Academic Content Expert - Chemistry(English)
QA solvers 3.00 to 7.00 Years Varanasi 30 Mar, 2024

Key Responsibilities Working on digital projects meant to cater to the K-20 segment Reviewing/Creating text and video content in English Providing quality content for 11-12th/NEET/JEE-mains/JEE...
Content creationEnglishChemistryDigital projectsAcademic content

Marketing Manager
IMS Learning Resources Pvt Ltd 3.00 to 7.00 Years Varanasi 30 Mar, 2024

Company Description IMS Learning Resources Pvt. Ltd. is a pioneering institution in management education training in India. Established in 1977, IMS has expanded into various sectors, providing t...
Market researchAnalytical skillsCommunication skillsProject managementDigital marketingMarketing strategiesProblemsolving skills

Project Manager
KINAL GLOBAL CARE PRIVATE LIMITED 1.00 to 6.00 Years Varanasi 30 Mar, 2024

Job description Job Description The Project Manager will be responsible for developing and executing end-to-end project management activities to achieve Global Payroll Organizations program g...
communication skillsdelivery managementscope managementproject managementproject performanceoperational excellenceproject executionoperations improvementproject initiation

Maintenance Technician
Mohinder Singh Hiring For Farm 1.00 to 6.00 Years Varanasi 30 Mar, 2024

Establishing and maintaining communication with the project team, management and stakeholders Coordinating project meetings and decision-making processes Executing the work, coordinating and supe...
project coordinationdocumentationquality controlprocess qualityquality managementoperations managementteam leadershipmaintenance engineering

Project Manager
KINAL GLOBAL CARE PRIVATE LIMITED 10.00 to 20.00 Years Varanasi 30 Mar, 2024

Job description Job Description The Project Manager will be responsible for developing and executing end-to-end project management activities to achieve Global Payroll Organizations program g...
project initiationproject managementproject executionproject schedulingoperations improvementproject performancecommunication skillsoperational excellencescope management

PREV
NEXT

project accounting Job Openings

Job description bachelors degree in engineering preferably in Mechanical, Electrical or Instrumentation with CGPA 7.0 or above; Minimum 8 years of experience in oil and ga... maximoschedulingmaterial managementpackaginghydraulicsinstrumentationorder managementms projectutility maintenance

Job description bachelors degree in engineering preferably in Mechanical, Electrical or Instrumentation with CGPA 7.0 or above; Minimum 8 years of experience in oil and ga... hydraulicsms projectmaximomaterial managementschedulingorder managementpackagingplant maintenanceinstrumentation

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Job description

bachelors degree in engineering preferably in Mechanical, Electrical or Instrumentation with CGPA 7.0 or above;

Minimum 8 years of experience in oil and ga...
maximoschedulingmaterial managementpackaginghydraulicsinstrumentationorder managementms projectutility maintenance

Job description

bachelors degree in engineering preferably in Mechanical, Electrical or Instrumentation with CGPA 7.0 or above;

Minimum 8 years of experience in oil and ga...
hydraulicsms projectmaximomaterial managementschedulingorder managementpackagingplant maintenanceinstrumentation