Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
Sales B2B REQUIREMENTS Excellent communication and interpersonal skills. Have passion for Sales and customer service. Good knowledge of major travel destinations Candidates from travel / Airline...
b2bsales tourpackages hospitalityindustry businesspromotion b2b sales hotel tours business bookings operations hospitality australasia communication B2C Accounts ManagedPrintServices B2G B2BMarketing aj QuaJOB DESCRIPTION DESIGNATION: SALES OFFICER Roles Responsibilities: Identifying, developing, and closing sales opportunities for adventure sports, Domestic International tour packages, Hotel Boo...
target retail android marketing sales nternationalrecruitment corporatesales customerrequirements strategicbusiness problemsolving channelpartners secondarysales tourpackages customerrelationship tradeshowsIdentifies business opportunities by identifying prospects and evaluating their position in the industry; researching and analyzing sales options. Maintains relationships with clients by providing sup...
travel visas holidays events visa ticketing tourism immigration olidaypackages travelagency tourbooking immigrationpolicy ticketingtools counsellor travelprocess touroperator tourpackages visaassistance visadocumentation officer eventpJob Description Experience 2.00 - 6.00 Years Vacancies 6 Perks, Incentives, ESOPs & Compensation details Candidate based in Implant earns 1000 as implant allowance per month which is over and ab...
ticketing amadeus galileo sabre air frontoffice exportimport airticketing tourpackages ticketbooking leisuretravel bordercontrol foreignexchange importmanagement airlineticketing financialservices peDesignation : Business Development / Sales Executive For Tour Packages / Travel Positively engaging with client and ensuring his final closure. Achieve monthly target Business development for various...
sales marketing businessdevelopment target customerrelations tourpackages his tours rentals business designation australasia TourDevelopment HollandAmerica HolidayPackages TourMarketing sc tedTours FamilyHJob Description Experience 2.00 - 6.00 Years Vacancies 6 Perks, Incentives, ESOPs & Compensation details Candidate based in Implant earns 1000 as implant allowance per month which is over and ab...
ticketing amadeus galileo sabre air airticketing tourpackages ticketbooking leisuretravel imp airlineticketing financialservices spectrummanagement xp timp dercontrol eignexchange tmanagementHandling of Inbound tour packages, making itineraries and costing for Inbound Tours. Desired Profile Should have good and sound knowledge of costing and itinerary preparation. Also computer literacy...
tourpackages computerliteracy tours sound costing english literacy itineraries TourDevelopment HollandAmerica HolidayPackages TourMarketing FamilyHolidays RomanticGetaways CulturalTours Pri sc tedToursHandling of Inbound tour packages, making itineraries and costing for Inbound Tours. Desired Profile Should have good and sound knowledge of costing and itinerary preparation. Also computer literac...
tourpackages computerliteracy tours sound costing english literacy itineraries TourDevelopment HollandAmerica HolidayPackages TourMarketing FamilyHolidays RomanticGetaways CulturalTours Pri sc tedToursJob Description Working Experience : 1 Year - 3 Years The candidate will be responsible for sales packages. Designing itinerary, costing, booking hotels. Handling Customers for international hol...
sales communication osting outbound tourpackages holidaypackages kingexperienceOpportunity to work With Hiring of Process Associates for Domestic and International process. (Airlines Travel) It is to handle either Sales or Customer care project. This project handles End to en...
galileo gds sabre ustomer fareportel igt ticking service convergys worldspan experida travelprocess hotelbooking holidaypackages interglobetechnologies apollo tourpackages reservationsticketingOpportunity to work With Hiring of Process Associates for Domestic and International process. (Airlines Travel) It is to handle either Sales or Customer care project. This project handles End to en...
galileo gds sabre ustomer fareportel igt ticking service convergys worldspan experida travelprocess hotelbooking holidaypackages interglobetechnologies apollo tourpackages reservationsticketingJOB DESCRIPTION DESIGNATION: SALES OFFICER Roles Responsibilities: Identifying, developing, and closing sales opportunities for adventure sports, Domestic International tour packages, Hotel Boo...
target retail android marketing sales nternationalrecruitment corporatesales customerrequirements strategicbusiness problemsolving channelpartners secondarysales tourpackages customerrelationship tradeshows
Requirement and Eligibility : The candidate should have a bachelor or equivalent degree. The candidate should have a minimum percentage of 60% in Bachelors or equivalent. Should be good in communicat...
bdm marketing immigration bpo advertising insurance kpo omesticticketing travelagencyoperations travel caller creditcard sale calling homeloans travelprocess visa telecaller services travelinsurance tourpackages overseas1 . Sell Individual and Corporate case and perform necessary checks to ensure full client eligibility. 2. Ensure all leads, potentials and cases taken are managed according to the Visas and Permits.c...
bdm marketing immigration bpo advertising insurance kpo omesticticketing travelagencyoperations travel caller creditcard sale calling homeloans travelprocess visa telecaller consultant travelinsurance tourpackages overseasWe are hiring for the below mentioned position in a leading travel industry Designation: Homebased agents(Freelancer) Location: Mumbai -Candidates must have good communication skills -Must have de...
tourpackages customerservice behavioraltraining bpo kpo ites less tours design salary operations australasia communication TourDevelopment HollandAmerica HolidayPackages TourMarketing EscortedTours amilyHoWe are hiring for the below mention position of the leading Travel Company: Designation: Sr.Executive- B2B Travel Sales Location:Chennai/Bengaluru/Dehradun/Bareilly/ Haridwar/Moradabad/ Jaipur/Amri...
b2bsales fieldsales travelsales agencysales channelsales b2bmarketing tourpackages behavioraltraining businessdevelopment b2b sales hotel tours salary agency business marketing australasia B2C ajorAccoWe are hiring for the below mention position of the leading Travel Company: Designation: Sr.Executive- B2B Travel Sales Location:Chennai/Bengaluru/Dehradun/Bareilly/ Haridwar/Moradabad/ Jaipur/Amri...
b2bsales fieldsales travelsales agencysales channelsales b2bmarketing tourpackages behavioraltraining businessdevelopment b2b sales hotel tours salary agency business marketing australasia B2C ajorAccoExperience in sale of tour packages both domestic and international. Experience of Europe location Experience in tour package preparation Salary 2 Lac To 5 Lac 50 Thousand P.A. Industry Hotel / Tra...
sales customerservice retail inventorymanagement marketing tourpackages hotel tours salary english australasia TourDevelopment HollandAmerica HolidayPackages TourMarketing EscortedTours FamilyHolidays omaWe are hiring for the below mention position of the leading Travel Company: Designation: Sr.Executive- B2B Travel Sales Location:Chennai/Bengaluru/Dehradun/Bareilly/ Haridwar/Moradabad/ Jaipur/Amri...
b2bsales fieldsales travelsales agencysales channelsales b2bmarketing tourpackages behavioraltraining businessdevelopment b2b sales hotel tours salary agency business marketing australasia B2C ajorAccoDear Candidates, Greetings from Flywidus! Urgent hiring for freelancers / Sales agents Responsibilities: 1) Cold calling and arranging the meetings with the Travel agents.(Data will be provided fo...
travel b2b freelancing marketing sales onboarding ealclosure agentrecruitment holidaypackages b2bmarketing travelagents outsidesales coldcalling interpersonalskills freelancer tourpackages b2bsales freelanceDesignation : Business Development / Sales Executive For Tour Packages / Travel Positively engaging with client and ensuring his final closure. Achieve monthly target Business development for various...
sales marketing businessdevelopment target customerrelations tourpackages his tours rentals business designation australasia TourDevelopment HollandAmerica HolidayPackages TourMarketing sc tedTours FamilyHWhisk Travelkaart, is seeking a proactive, self-starting Business Development Manager with a knack for public speaking and an ability to build iron-clad business relationships. Experience in the trave...
target tourism marketing sales tours eisureindustry hollandamerica touroperators tourdevelopment tourmarketing escortedtours romanticgetaways businessdevelopment customerrelations familyholidays culturaltours holidaypackages tourpackagesJob Description Experience 2.00 - 6.00 Years Vacancies 6 Perks, Incentives, ESOPs & Compensation details Candidate based in Implant earns 1000 as implant allowance per month which is over and ab...
ticketing amadeus galileo sabre air airticketing tourpackages ticketbooking leisuretravel imp airlineticketing financialservices spectrummanagement xp timp dercontrol eignexchange tmanagementUrgent opening with Company and Many more options available. Handle Incoming/outgoing call from the clients. Resolving customer issues over call EXCELLENT Communication Skills Shift Timing - Rotat...
telesales ravelagency bposales voiceprocess dayshift internationalticketing travelprocess fresherscalling rotationaloff graduates internationalbpo holidaypackages tourpackages bpofreshers excellentcommunicationskills freshers callcenterUrgent opening with Company and Many more options available. Handle Incoming/outgoing call from the clients. Resolving customer issues over call EXCELLENT Communication Skills Shift Timing - Rotat...
telesales ravelagency bposales voiceprocess dayshift internationalticketing travelprocess fresherscalling rotationaloff graduates internationalbpo holidaypackages tourpackages bpofreshers excellentcommunicationskills freshers callcenterUrgent opening with Company and Many more options available. Handle Incoming/outgoing call from the clients. Resolving customer issues over call EXCELLENT Communication Skills Shift Timing - Rotat...
telesales ravelagency bposales voiceprocess dayshift internationalticketing travelprocess fresherscalling rotationaloff graduates internationalbpo holidaypackages tourpackages bpofreshers excellentcommunicationskills freshers callcenterUrgent opening with Company and Many more options available. Handle Incoming/outgoing call from the clients. Resolving customer issues over call EXCELLENT Communication Skills Shift Timing - Rotat...
telesales oiceprocess graduates excellentcommunicationskills rotationalshift freshers outboundsales bposales rotationaloff internationalticketing travelprocess internationalbpo bpofreshers fresherscalling dayshift tourpackagesUrgent opening with Company and Many more options available. Handle Incoming/outgoing call from the clients. Resolving customer issues over call EXCELLENT Communication Skills Shift Timing - Rotat...
telesales olidaypackages tourpackages voiceprocess telecaller bposales travelprocess internationalbpo excellentcommunicationskills callcenter fresherscalling undergraduates chatprocess outboundsales bpofreshers dayshift rotationaloff travUrgent opening with Company and Many more options available. Handle Incoming/outgoing call from the clients. Resolving customer issues over call EXCELLENT Communication Skills Shift Timing - Rotat...
telesales oiceprocess graduates excellentcommunicationskills rotationalshift freshers outboundsales bposales rotationaloff internationalticketing travelprocess internationalbpo bpofreshers fresherscalling dayshift tourpackagesUrgent opening with Company and Many more options available. Handle Incoming/outgoing call from the clients. Resolving customer issues over call EXCELLENT Communication Skills Shift Timing - Rotat...
telesales olidaypackages tourpackages voiceprocess telecaller bposales travelprocess internationalbpo excellentcommunicationskills callcenter fresherscalling undergraduates chatprocess outboundsales bpofreshers dayshift rotationaloff travUrgent opening with Company and Many more options available. Handle Incoming/outgoing call from the clients. Resolving customer issues over call EXCELLENT Communication Skills Shift Timing - Rotat...
telesales oiceprocess graduates excellentcommunicationskills rotationalshift freshers outboundsales bposales rotationaloff internationalticketing travelprocess internationalbpo bpofreshers fresherscalling dayshift tourpackagesUrgent opening with Company and Many more options available. Handle Incoming/outgoing call from the clients. Resolving customer issues over call EXCELLENT Communication Skills Shift Timing - Rotat...
telesales olidaypackages tourpackages voiceprocess telecaller bposales travelprocess internationalbpo excellentcommunicationskills callcenter fresherscalling undergraduates chatprocess outboundsales bpofreshers dayshift rotationaloff travHandling of Inbound tour packages, making itineraries and costing for Inbound Tours. Desired Profile Should have good and sound knowledge of costing and itinerary preparation. Also computer literac...
tourpackagescomputerliteracytourssoundcostingenglishliteracyitinerariesTourDevelopmentHollandAmericaHolidayPackagesTourMarketingFamilyHolidaysRomanticGetawaysCulturalToursPritedToursHandling of Inbound tour packages, making itineraries and costing for Inbound Tours. Desired Profile Should have good and sound knowledge of costing and itinerary preparation. Also computer literacy...
tourpackagescomputerliteracytourssoundcostingenglishliteracyitinerariesTourDevelopmentHollandAmericaHolidayPackagesTourMarketingFamilyHolidaysRomanticGetawaysCulturalToursPritedToursJob Description Experience 2.00 - 6.00 Years Vacancies 6 Perks, Incentives, ESOPs & Compensation details Candidate based in Implant earns 1000 as implant allowance per month which is over and ab...
ticketingamadeusgalileosabreairairticketingtourpackagesticketbookingleisuretravelimpairlineticketingfinancialservicesspectrummanagementtimpdercontroleignexchangetmanagementUrgent opening with Company and Many more options available. Handle Incoming/outgoing call from the clients. Resolving customer issues over call EXCELLENT Communication Skills Shift Timing - Rotat...
telesalesutboundsalesvoiceprocessundergraduatestravelagencyinternationalticketingholidaypackagesgraduatesfresherscallingtourpackagesdayshiftinternationalbpoexcellentcommunicationskillsbposalesrotationalshiftgoodcommunicationskillstravelproResponsibilities
Urgent opening with Company and Many more options available. Handle Incoming/outgoing call from the clients. Resolving customer issues over call EXCELLENT Communication Skills Shift Timing - Rotat...
telesalesutboundsalesvoiceprocessundergraduatestravelagencyinternationalticketingholidaypackagesgraduatesfresherscallingtourpackagesdayshiftinternationalbpoexcellentcommunicationskillsbposalesrotationalshiftgoodcommunicationskillstravelproUrgent Hiring for Sr. Reservation Executive Profile - Sr. Reservation Executive Salary - 40K to 45K Location - Delhi Industry - Tour & Travel Qualification - Graduate / Post Graduate Experience ...
holidaysreservationticketingeservationsticketingtourpackagesairlinereservationsairlineticketing1 . Sell Individual and Corporate case and perform necessary checks to ensure full client eligibility. 2. Ensure all leads, potentials and cases taken are managed according to the Visas and Permits.c...
bdmmarketingimmigrationbpoadvertisinginsurancekpoomesticticketingtravelagencyoperationstravelcallercreditcardsalecallinghomeloanstravelprocessvisatelecallerconsultanttravelinsurancetourpackagesoverseas
Job Description - Handling of Inbound tour packages, making itineraries and costing for Inbound Tours. Desired Profile - Must be a graduate. Good and sound knowledge of costing and itinerary preparat...
tourpackagescomputerliteracytourssoundcostingenglishliteracypreparationitinerariesTourDevelopmentHollandAmericaHolidayPackagesTourMarketingFamilyHolidaysRomanticGetawaystedToursCulturalCompany Name -- A1 Tours Pvt Ltd Website -- http://a1tours.co.in Qualification- Graduation Experience- 1-3 years Salary- 20k-35k Job Location New Delhi Working Hours- 10: 00 AM to 6:00 PM For furthe...
salestourismustomerservicecustomersupporttourpackagesinboundcallstourbookingtravelsalestourplanningtravelconsultingCompany Name -- A1 Tours Pvt Ltd Website -- http://a1tours.co.in Qualification- Graduation Experience- 1-3 years Salary- 20k-35k Job Location New Delhi Working Hours- 10: 00 AM to 6:00 PM For furthe...
salestourismustomerservicecustomersupporttourpackagesinboundcallstourbookingtravelsalestourplanningtravelconsultingUrgent opening with Company and Many more options available. Handle Incoming/outgoing call from the clients. Resolving customer issues over call EXCELLENT Communication Skills Shift Timing - Rotat...
telesalesoiceprocessfreshersbpofreshersholidaypackagesexcellentcommunicationskillsdayshiftgoodcommunicationskillsoutboundsalesinternationalbpoundergraduatesrotationalshiftgraduatesbposalestravelprocessfresherscallingtourpackagesUrgent opening with Company and Many more options available. Handle Incoming/outgoing call from the clients. Resolving customer issues over call EXCELLENT Communication Skills Shift Timing - Rotat...
telesalesoiceprocessbpofreshersholidaypackagesexcellentcommunicationskillsdayshiftgraduatesoutboundsalesinternationalticketinginternationalbpoundergraduatesrotationalshifttravelagencybposalestravelprocessfresherscallingtourpackagesUrgent opening with Company and Many more options available. Handle Incoming/outgoing call from the clients. Resolving customer issues over call EXCELLENT Communication Skills Shift Timing - Rotat...
telesalesoiceprocessfreshersbpofreshersholidaypackagesexcellentcommunicationskillsdayshiftgoodcommunicationskillsoutboundsalesinternationalbpoundergraduatesrotationalshiftgraduatesbposalestravelprocessfresherscallingtourpackagesUrgent opening with Company and Many more options available. Handle Incoming/outgoing call from the clients. Resolving customer issues over call EXCELLENT Communication Skills Shift Timing - Rotat...
telesalesoiceprocessbpofreshersholidaypackagesexcellentcommunicationskillsdayshiftgraduatesoutboundsalesinternationalticketinginternationalbpoundergraduatesrotationalshifttravelagencybposalestravelprocessfresherscallingtourpackagesHiring for Reputed MNC International voice Domain-Travel process Salary upto 29,800 Unlimited incentives Shifts-24*7(US) Undergraduates or graduates with minimum six months of experience(Mandato...
worldspanincentivesgdssalaryfaresenglishaustralasiaticketingopeningscalbonusmadeusgdsholidaypackagesairlinereservationsgdssystemsinternationalvoiceairlineeconomicstravelprocessairlineticketingtourpackages© 2019 Hireejobs All Rights Reserved