Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
Technical Lead / Technical Architect ( . Net Azure) Date : 12-08-2019 Software Engineer / Technical Lead (PERL) - Storage Test Automation Date : 12-08-2019 Senior Engineer / Technical Lead (Embedd...
distributedsystems net software automation Scalability LargeScaleSystems Kernel FileSystems DistributedDatabases ParallelComputing GridComputing age DistributedAlg ithms DistributedSt age WindowsCommunicSkills Knowledge of MS SQL 2008 Banking domain Work on biometrics devices Job Description Design, modify, develop, write and implement software Programming applications and components Enha...
sqlserver net jquery javascript html mssql sql design banking software research components biometrics evaluation enhancements SQLServerIntegrationServices ransactSQL SQLServerRep tingServices WindowsCommunicDot Net Developers 1. 2- 3 years experience in web based and intranet projects 2. . NET with C# and MS SQL server 2005 above 3. AJAX, XML, HTML, JavaScript, Jquery 4. Fluency in English,...
sqlserver net jquery javascript html mssqlserver mssql projectadministration sql xml net dot ajax english intranet SQLServerIntegrationServices ransactSQL SQLServerRep tingServices WindowsCommunic.Net Developer - 2yrs to 3 yrs Experience of developing enterprise applications in .NET (C# , ASP.NET , VB.NET) , AJAX etc. Understanding of OOPS , MVC and Design Pattern. Experience of working in SQL...
sqlserver enterpriseapplications sql net ajax oops rdbms sound oracle design onbase databases enterprise fundamentals SQLServerReportingServices SQLServerIntegrationServices spnet TransactSQL WindowsCommunica highly motivated individual with 2 years of experience in microsoft technologies. a very good understanding and experience in design patterns, n- tier architecture and coding frameworks. good commun...
sqlserver designpatterns communicationskills sql net design vbnet architecture communication SQLServerIntegrationServices etframew cnet aspnet TransactSQL SQLServerRep tingServices WindowsCommunica highly motivated individual with 2 years of experience in microsoft technologies. a very good understanding and experience in design patterns, n- tier architecture and coding frameworks. good commun...
sqlserver designpatterns communicationskills sql net design vbnet architecture communication SQLServerIntegrationServices etframew cnet aspnet TransactSQL SQLServerRep tingServices WindowsCommunicTechnical Lead / Technical Architect ( . Net Azure) Date : 12-08-2019 Software Engineer / Technical Lead (PERL) - Storage Test Automation Date : 12-08-2019 Senior Engineer / Technical Lead (Embedd...
distributedsystems net software automation Scalability LargeScaleSystems Kernel FileSystems DistributedDatabases ParallelComputing GridComputing age DistributedAlg ithms DistributedSt age WindowsCommunicSkills Knowledge of MS SQL 2008 Banking domain Work on biometrics devices Job Description Design, modify, develop, write and implement software Programming applications and components Enhanc...
sqlserver net jquery javascript html mssql sql design banking software research components biometrics evaluation enhancements SQLServerIntegrationServices ransactSQL SQLServerRep tingServices WindowsCommunicSkills Knowledge of MS SQL 2008 Banking domain Work on biometrics devices Job Description Design, modify, develop, write and implement software Programming applications and components Enha...
sqlserver net jquery javascript html mssql sql design banking software research components biometrics evaluation enhancements SQLServerIntegrationServices ransactSQL SQLServerRep tingServices WindowsCommunica highly motivated individual with 2 years of experience in microsoft technologies. a very good understanding and experience in design patterns, n- tier architecture and coding frameworks. good commun...
sqlserverdesignpatternscommunicationskillssqlnetdesignvbnetarchitecturecommunicationSQLServerIntegrationServicesetframewcnetaspnetTransactSQLSQLServerReptingServicesWindowsCommunicExp:- 3 to 8 Yrs NP:- Immediate to 60 days Developer Over 1 years BPM Online consultancy experience Strong understanding of BPM Online Strong Technical Experience of BPM Online & Certified profes...
microsoftsqlserversqlserverlifecycleproblemsolvingonlineconsultancymicrosoftsqlsqlbpmconsultancycommunicationSQLServerIntegrationServicesransactSQLSQLServerReptingServicesWindowsCommunicJob Title: Sr. Application Developer Job Id: Description: 3+ Years of Experience in .net Framework Specially ASP.NET, SQL Server 2008, Ajax Tools , XML / XAML , HTML , Java Scripts, CSS ,IIS. click he...
cssajaxxamlsqljavascriptshtmljavascriptnetxmlqlserversqlserverreportingservicesnetframeworksqlserverintegrationservicesaspnettransactsqlsqlserver2008customerrelationswindowscommunic© 2019 Hireejobs All Rights Reserved