Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
1. Capital Markets domain understanding Mandatory 2. Fixed Income instruments, Trade Life cycle and allocation, Short Term Desk activities knowledge will be added advantage 3. Java Architect shoul...
java hibernate agile tomcat angularjs tradelifecycle lifecycle fixedincome messagequeue capitalmarkets accountmanagement sql plsql spring capital java aclesql clientco dination acle offshAbout the role: Manage multiple teams within Operations function. The incumbent will be responsible to manage operations, Ensure operational risk management along with managing staff, performing adm...
operationalriskmanagement tradelifecycle lifecycle musicmaking riskmanagement operationalrisk businessrequirements risk business platinum management operations administration Sanction USAPATRIOTAct peration1. Capital Markets domain understanding Mandatory 2. Fixed Income instruments, Trade Life cycle and allocation, Short Term Desk activities knowledge will be added advantage 3. Java Architect shoul...
java hibernate agile tomcat angularjs tradelifecycle lifecycle fixedincome messagequeue capitalmarkets accountmanagement sql plsql spring capital java aclesql clientco dination acle offsh1. Capital Markets domain understanding Mandatory 2. Fixed Income instruments, Trade Life cycle and allocation, Short Term Desk activities knowledge will be added advantage 3. Java Architect shoul...
java hibernate agile tomcat angularjs tradelifecycle lifecycle fixedincome messagequeue capitalmarkets accountmanagement sql plsql spring capital java aclesql clientco dination acle offsh1. Capital Markets domain understanding Mandatory 2. Fixed Income instruments, Trade Life cycle and allocation, Short Term Desk activities knowledge will be added advantage 3. Java Architect shoul...
java hibernate agile tomcat angularjs tradelifecycle lifecycle fixedincome messagequeue capitalmarkets accountmanagement sql plsql spring capital java aclesql clientco dination acle offsh
A people manager role. Apart from team and delivery management, the incumbent is expected to understand and manage the technical aspects of the process suggest enhancements, suggest / im...
finance sales ltd mis accountancy peoplemanagementskills stronganalyticalskills businesscontinuitymanagement tradelifecycle sixsigma msoffice lifecycle rolemodel fixedincome servicelevel spendanalysis riskmanagement servicedelivery assetFinancial Markets - Senior Process Manager - Transition ManagementJob ID: 38263 | eClerx Id | eClerx DESCRIPTIONAbout eClerx: India s leading process management and data analytics companies, eClerx ...
projectmanagement delivery customerrelations processimprovement management businessprocessmanagement tradelifecycle sixsigma eni statementsofw ksow kunderminimalsupervision mediaentertainmentFinancial Markets - Associate Program Manager - Risk Management The Ideal Experience Map: Minimum 6 years of experience in business analysis , data management , change , consulting , or process manag...
sales net customerrelations datamanagement documentation businessprocessmanagement tradelifecycle baselii lifecycle creditrisk marketrisk risksystems dataanalytics liquidityrisk ediaentertainment1. Capital Markets domain understanding Mandatory 2. Fixed Income instruments, Trade Life cycle and allocation, Short Term Desk activities knowledge will be added advantage 3. Java Architect shoul...
java hibernate agile tomcat angularjs tradelifecycle lifecycle fixedincome messagequeue capitalmarkets accountmanagement sql plsql spring capital java aclesql clientco dination acle offshMurex BAU & Technical Support for a large European Bank Responsibilities Murex related Responsibilty: 1) Handling Murex production batch processing includes Date rolls for Various desks and entities...
sql unix sqlserver sla unixshellscripting tradelifecycle creditrisk marketrisk marketdata shellscripting processcontrol roductionsupp interestratederivatives lifecycle backoffice filesystem1. Capital Markets domain understanding Mandatory 2. Fixed Income instruments, Trade Life cycle and allocation, Short Term Desk activities knowledge will be added advantage 3. Java Architect shoul...
java hibernate agile tomcat angularjs tradelifecycle lifecycle fixedincome messagequeue capitalmarkets accountmanagement sql plsql spring capital java aclesql clientco dination acle offshAbout the role: Manage multiple teams within Operations function. The incumbent will be responsible to manage operations, Ensure operational risk management along with managing staff, performing adm...
operationalriskmanagement tradelifecycle lifecycle musicmaking riskmanagement operationalrisk businessrequirements risk business platinum management operations administration Sanction USAPATRIOTAct peration
Murex BAU & Technical Support for a large European Bank Responsibilities Murex related Responsibilty: 1) Handling Murex production batch processing includes Date rolls for Various desks and entities...
sqlunixsqlserverslaunixshellscriptingtradelifecyclecreditriskmarketriskmarketdatashellscriptingprocesscontrolroductionsuppinterestratederivativeslifecyclebackofficefilesystemFinancial Markets - Senior Process Manager - Transition ManagementJob ID: 38263 | eClerx Id | eClerx DESCRIPTIONAbout eClerx: India s leading process management and data analytics companies, eClerx ...
projectmanagementdeliverycustomerrelationsprocessimprovementmanagementbusinessprocessmanagementtradelifecyclesixsigmaenistatementsofwksowkunderminimalsupervisionmediaentertainment
The Prime Services Middle Office (MO) Department is responsible for facilitating the clearance and settlement of transactions in the Equity Prime Brokerage and Fixed Income Prime Brokerage, and the Br...
accountssubjectmatterexpertisetradelifecyclemsofficelifecyclefixedincomemiddleofficeprimebrokeragetimemanagementhumanresourcesservicecentersassetmanagementting
Brief Across the globe, institutional investors rely on us to help them manage risk, respond to challenges, and drive performance and profitability. We keep our clients at the heart of everything we...
insurancequalitysalesmistradelifecyclesharedservicespaymentsystemsustomerrelationsstatementsofwksowstronginterpersonalskillsstandardoperatingprocedureslifecycleriskcontroltradingdeskBrief Across the globe, institutional investors rely on us to help them manage risk, respond to challenges, and drive performance and profitability. We keep our clients at the heart of everything we d...
insurancequalitysalesmistradelifecyclesharedservicespaymentsystemsclientservicingustomerrelationsstatementsofwksowstandardoperatingprocedureslifecycleriskcontroltradingdeskdeadlineoLooking to hire a senior technology manager and overall team lead of the Business Performance Measurement data analytics team in Pune. The team is expected to expand it s footprint in 2019. The staffi...
mtpmultithreadingscriptingsasanalyticsoperationswebservicesallocationmiddlewarearchitecturespringtradelifecycleerfmancetuningJob Title: TP Sr. Analyst Division: BPS Location: Pune Reporting to: Team Leader Roles Reporting to this Position: None Specific Duties:...
swiftreposriskcapitalbpsforwardsanalysisoneymarketcapitalmarketfixedincometradelifecyclelifecyclemoneymarketfunds© 2019 Hireejobs All Rights Reserved