Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
Would you relish the responsibility of owning and managing a number of key applications within Credit Risk We re looking for someone like that who can help us: manage the entry and regular affirmati...
creditrisk frontoffice risksystems workeffectively changemanagement wealthmanagement managementsystems communicationskills verbalcommunication applicationmanagement tatementsofworksowDo you have the know-how for designing and delivering effective reports We re looking for a technology and design analyst to: define and set global risk reporting standards in conjunction with senio...
centerofexcellence dataqualitycontrol dataquality risksystems qualitycontrol seniormanagement financialservices processautomation knowledgediscovery reportingrequirements riskreporting reativesolutions
AVP - Credit Policy We have been retained by our client, a reputed multinational Bank to identify a AVP - Credit Policy to be based at Mumbai. JOB PURPOSE: To carry full responsibili...
creditrisk riskanalysis riskmanagement relationshipbuilding risk rivechange risksystems creditpolicy earlywarning creditapproval businessschools legaldocumentation inf mationsharing set excel soundAVP - Credit Policy We have been retained by our client, a reputed multinational Bank to identify a AVP - Credit Policy to be based at Mumbai. JOB PURPOSE: To carry full responsibili...
creditrisk riskanalysis riskmanagement relationshipbuilding risk rivechange risksystems creditpolicy earlywarning creditapproval businessschools legaldocumentation inf mationsharing set excel soundFinancial Markets - Associate Program Manager - Risk Management The Ideal Experience Map: Minimum 6 years of experience in business analysis , data management , change , consulting , or process manag...
sales net customerrelations datamanagement documentation businessprocessmanagement tradelifecycle baselii lifecycle creditrisk marketrisk risksystems dataanalytics liquidityrisk ediaentertainmentSenior Manager, Fraud and Risk Management Person in this role will be responsible for reviewing and building policies and risk controls for Risk Management and Fraud Detection. Provide domain e...
mis accountancy financialcrimesinvestigations riskcontrol newbusiness risksystems dataanalytics businessrules riskanalytics customerfocus riskmanagement tatementsofworksow
Process Overview The FAKC (Finance and Accounting Knowledge Center) was set up in 2007 as a part of the CFO Global Delivery strategy to provide offshore del...
PRIMARY DUTIES AND RESPONSIBILITIES:
PRIMARY DUTIES AND RESPONSIBILITIES:
The Mumbai analyst will be responsible for the following: 1)Market focus: a.Being on top of market activity new asset classes, issuance, price volatility etc. b.Analyze market events and the...
sales insurance quality frontoffice fixedincome scheduling equityresearch shellscripting creditresearch ustomerrelations technicalsupp globalteams risksystems bondmarkets equityindicesJ.P. Morgan is a leading global financial services firm, established over 200 years ago: o We are the leader in investment banking, financial services for consumers and small businesses, commercial ba...
sales customerrelations quality coaching risksystems musicmaking microsoftexcel humanresources eventmanagement assetmanagement productknowledge ontrolframewJob Title : Liquidity Risk Reporting - Analyst Job Location : Chennai Support the overall production and submission of Liquidity Risk Reports to internal stakeholders and regulators, whilst ensuring ...
dataquality risksystems balancesheet qualitycheck liquidityrisk keymanagement microsoftexcel presentationskills communicationskills ep tingtools externalrep ting riskrep tingAVP - Credit Policy We have been retained by our client, a reputed multinational Bank to identify a AVP - Credit Policy to be based at Mumbai. JOB PURPOSE: To carry full responsibili...
creditrisk riskanalysis riskmanagement relationshipbuilding risk rivechange risksystems creditpolicy earlywarning creditapproval businessschools legaldocumentation inf mationsharing set excel soundGlobal Research Center Mumbai GLOBAL INDEX RESEARCH Junior Analyst / Analyst J.P. Morgan s Global Research Center (GRC) in Mumbai was set up in August, 2003 as an extensi...
marketdatarisksystemscreditderivativesstructuredproductsreditresearchfinancialservicesSenior Support Analyst with ref. Our client , a leading investment brokerage firm is looking for a Senior Support Analyst for their Pune office. The successful candidate will closely work with primary...
unixsqlchangemanagementincidentmanagementslafronttobackofficebackofficefixedincomerisksystemscomputersciencereleasemanagementequityderivativesquantitativemanagementuatroductionsuppThe Test Analyst will be part of the MR IT QA team who will be involved in preparation, execution of testing activities as part of the STLC process for one or more projects of the Market Risk systems ...
qualityauditingcalibrationestanalysistestautomationtestscriptsautomationtestingmarketriskcustomerrelationsrisksystemstestcasesbusinessrequirementsBank Of America Job - Manager , Hyderabad, India Overview: Bank of America is one of the world s leading financial institutions, serving individual consumers, small and middle- market businesses an...
dataminingmarketriskdataqualityriskanalysisriskmanagementdatamanagementassetmanagementbusinessprocessriskusinessprocesstransfmationrisksystemsmiddleofficegoldensourcereferencedataDetailed Team Responsibilities: - Perform daily reconciliation of the Risk systems attributed P&L to the Reporting system. - Identify and investigate breaks. - Escalate issues in a timely manner to ma...
riskbasistradingledgeralancesheetrisksystemsfrontofficeAn application developer with strong DB skills and working experience in Java/Big Data technology is needed to work in FRM IT- Market Risk Exposure development team in India. The FRM IT Market Risk E...
sqlsqlservermysqldatabaseadministrationmarketriskproblemsolvingwealthmanagementinvestmentbankingfinancialservicesustomerrelationsbigdataejavarisksystemsmiddleofficelargeprojectsriskgovernanceanalyticaOverview: Managing & delivering production Credit Risk KPIs and KRIs. Continuously improve existing processes and functions to remove all manual and non-value adding activities with a goal to r...
msaccesscreditriskkeymetricsfrontofficerisksystemsmiddleofficesmallbusinessproblemsolvingmanagementinvestmentbankingtatementsofwksowseniedproceduresateliaisonAVP - Credit Policy We have been retained by our client, a reputed multinational Bank to identify a AVP - Credit Policy to be based at Mumbai. JOB PURPOSE: To carry full responsibili...
creditriskriskanalysisriskmanagementrelationshipbuildingriskrivechangerisksystemscreditpolicyearlywarningcreditapprovalbusinessschoolslegaldocumentationinfmationsharingsetexcelsound- manage & overview daily reconciliation of the Risk systems attributed P&L to the Reporting system - drive controls; help the team in identifying and investigation of breaks; escalate issues in a tim...
ledgertradingbasisixedincomederivativesfixedincomefrontofficewealthmanagementproblemsolvingreportingsystemsfinancialservibalancesheetproductcontrolcapitalmarketsrisksystemsfinancialcontrolinvestmentbankingAn application developer with strong DB skills and working experience in Java/Big Data technology is needed to work in FRM IT- Market Risk Exposure development team in India. The FRM IT Market Risk E...
sqlsqlservermysqldatabaseadministrationmarketriskproblemsolvingwealthmanagementinvestmentbankingfinancialservicesustomerrelationsbigdataejavarisksystemsmiddleofficelargeprojectsriskgovernanceanalytica© 2019 Hireejobs All Rights Reserved