Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
POSITION SUMMARY STATEMENT: The Oracle Apps Database Administrator will have primary responsibility for the operation of Oracle Business Suite 11.5.x and non-Oracle Applications Oracle Databases. Th...
datarecovery servicelevel versioncontrol databasedesign computerscience spacemanagement changemanagement cleebusinesssuite acleenterprisemanager acle10g aclerac acleapps keffectivelyJava Developer Java Developer POSITION: Junior / Senior - Java Developer JOB LOCATION: Mumbai , India EDUCATION: Graduate / post-graduate degree EXPERIENCE: 3 to 6 Years MODE OF HIRING: Permanent / Fu...
java mysql jsp hibernate spring webservices unittesting problemsolving designpatterns analyticalskills communicationskills writtencommunication api jdk j2ee ajax java acle10g springframew acSkills specification Strong experience in installations and configurations of Oracle 10g and 11g versions Possess procedural skills to help design, debug, implement, and maintain stored procedures...
datamodeling datasecurity systemanalysis databasedesign capacityplanning sql java cledba acle10g st edprocedures commercialmodels st agemanagement metadatamanagement perf mancemanagement 11gDatabase Administrator Experience in Database Administration Database Administrator Careers Job Detail Database Administrator Experience in Database Administration Experience(s) : 1Year Overview L...
databases sqlserver sql databaseadministration rman unixshellscripting itservices uidevelopment shellscripting monit disasterrecovery data cledba acle10g acle11g ingtools databasemonit ingResponsible for preparing Technical Design Documents. Involved in analysis, design and business logic. Should involve in developing interface from different system. To implement Mail Alert System. ...
sql sales customerrelations plsql technicaldesign databasetriggers mail design control objects business analysis database WebPDM ms acle10g st edprocedures rep tdevelopment acle sqlplusStrong experience in installations and configurations of Oracle 10g and 11g versions Possess procedural skills to help design, debug, implement, and maintain stored procedures, triggers, and user- d...
datamodeling datasecurity systemanalysis databasedesign capacityplanning cledba acle10g st edprocedures commercialmodels st agemanagement metadatamanagement perf mancemanagement professionalliDescription The incumbent in this position serves as a senior Java J2EE architect for 2 separate IT projects involving the CRASH accident reporting system. One project involves supporting a public- ...
businessobjectsxi businessobjects projectplanning applicationdevelopment xml jsp java html j2ee soap sdlc json rest ullsdlc acle10g itprojects generalpublic st edprocedures it aclePOSITION SUMMARY STATEMENT: The Oracle Apps Database Administrator will have primary responsibility for the operation of Oracle Business Suite 11.5.x and non-Oracle Applications Oracle Databases. Th...
datarecovery servicelevel versioncontrol databasedesign computerscience spacemanagement changemanagement cleebusinesssuite acleenterprisemanager acle10g aclerac acleapps keffectivelyhould have sound experience in functional analysis , design , development , coding , implementation , maintenance and support in different domain with different technologies like java , jsp , Servlet ...
frontend dataflow testcases sqlqueries clientside explainplan flowdiagrams datamigration problemsolving datadictionary clepl acle9i acle10g acletext clientsupp acledatabaseResponsible for preparing Technical Design Documents. Involved in analysis, design and business logic. Should involve in developing interface from different system. To implement Mail Alert System. ...
sql sales customerrelations plsql technicaldesign databasetriggers mail design control objects business analysis database WebPDM ms acle10g st edprocedures rep tdevelopment acle sqlplusSkills specification Strong experience in installations and configurations of Oracle 10g and 11g versions Possess procedural skills to help design, debug, implement, and maintain stored procedures...
datamodeling datasecurity systemanalysis databasedesign capacityplanning sql java cledba acle10g st edprocedures commercialmodels st agemanagement metadatamanagement perf mancemanagement 11g
Description The incumbent in this position serves as a senior Java J2EE architect for 2 separate IT projects involving the CRASH accident reporting system. One project involves supporting a public- ...
businessobjectsxi businessobjects projectplanning applicationdevelopment xml jsp java html j2ee soap sdlc json rest ullsdlc acle10g itprojects generalpublic st edprocedures it acleDescription The incumbent in this position serves as a senior Java J2EE architect for 2 separate IT projects involving the CRASH accident reporting system. One project involves supporting a public- ...
businessobjectsxi businessobjects projectplanning applicationdevelopment xml jsp java html j2ee soap sdlc json rest ullsdlc acle10g itprojects generalpublic st edprocedures it acle
Support Engineer- IT Industry Add to cart Job Title Support Engineer- IT Industry Language level English Industry Technology&Online Language level Japanese Sub- Industry Online B2C Services ...
troubleshooting lan operatingsystems switches microsoftsqlserver mssql testdata sqlserver webservices visualstudio microsoftsql etw king mssqlserver aclesql acle10g servermanagement itExperienceRole: Oracle DBAExp: 4 - 9 yrs;Location: ChennaiSkills specificationStrong experience in installations and configurations of Oracle 10g and 11g versionsPossess procedural skills to help desi...
datamodeling datasecurity systemanalysis databasedesign sql com java j2ee dbms cledba acle10g st edprocedures commercialmodels st agemanagement metadatamanagement perf mancemanagement 11g acDatabase Administrator Experience in Database Administration Database Administrator Careers Job Detail Database Administrator Experience in Database Administration Experience(s) : 1Year Overview L...
databases sqlserver sql databaseadministration rman unixshellscripting itservices uidevelopment shellscripting monit disasterrecovery data cledba acle10g acle11g ingtools databasemonit inghould have sound experience in functional analysis , design , development , coding , implementation , maintenance and support in different domain with different technologies like java , jsp , Servlet ...
frontend dataflow testcases sqlqueries clientside explainplan flowdiagrams datamigration problemsolving datadictionary clepl acle9i acle10g acletext clientsupp acledatabaseJava Developer Java Developer POSITION: Junior / Senior - Java Developer JOB LOCATION: Mumbai , India EDUCATION: Graduate / post-graduate degree EXPERIENCE: 3 to 6 Years MODE OF HIRING: Permanent / Fu...
java mysql jsp hibernate spring webservices unittesting problemsolving designpatterns analyticalskills communicationskills writtencommunication api jdk j2ee ajax java acle10g springframew ac(2-5 years) Expertise in Oracle Forms Reports and good Command of PL/ SQL Job Profile Developers with 2-5 years of relevant experience in Oracle Forms Reports / PL SQL programming can apply. Must be...
sql d2k ts lsql ms acle command business acle10g acled2k rep ts6i d2krep aclef ms5 Years of experience as a Production Oracle DBA Well versed is Oracle 10g and 11g releases and good exposure to HA s with RAC/ ASM & DataGuard Expert & hands on with SQL Tuning using Explain Plan, ...
sql asm rac awr dataguard sqltuning troubleshooting 1g ash acle database acledba acle10g perf mance explainplanCandidate should have 5- 7 years of exp. in Oracle Database Administration and in Production support environments. Good understanding of the Oracle database architecture ( Single Instance, RAC and A...
relationaldatabases databasearchitecture databaseadministration rac rman 11gr2 11gr1 sizing security database cledatabaseadministration acledba acle10g acledatabase productionsupp acle st age1. Extensive knowledge of Oracle Database Administration 2. DBA skills on Oracle 10g is must and 11g is preferable 3. OS skills: Linux, Unix, Mac OS X (Preferred) 4. Essential DBA skills: Exp. i...
macosx osx macos communicationskills databaseadministration os 11g mac asm rac unix 24x7 linux database databases cledatabaseadministration acle10g acledatabase perf mancetuning acleThis role supports large numbers of in-life key operational oracle databases and applications for Technology and Group LOBs. The successful candidate is expected to contribute to occasional ...
drawing autocad drafting modeling cad furthereducation emergencyservices incidentmanagement cledatabaseadministration acle10g acledatabase technicalsupp productionsupp kingenvironmentCandidate should have 5- 7 years of exp. in Oracle Database Administration and in Production support environments. Good understanding of the Oracle database architecture ( Single Instance, RAC and A...
relationaldatabases databasearchitecture databaseadministration rac rman 11gr2 11gr1 sizing security database cledatabaseadministration acledba acle10g acledatabase productionsupp acle st ageSolution Designer CC&B (Customer Care & Billing) for TCS- Riyadh/Bangalore | Forstaffing Solution Designer CC&B (Customer Care & Billing) for TCS- Riyadh/Bangalore August 26, 2019 | Filed under: | Pub...
javasolutiondesignosstelecomdeliveryxmlschemawebservicessoagovernanceweblogicserverdatabasedesigncomputerclesoasuiteacleweblogicserveraclesoaacle10gderaclesuppSkills specification Strong experience in installations and configurations of Oracle 10g and 11g versions Possess procedural skills to help design, debug, implement, and maintain stored procedures...
datamodelingdatasecuritysystemanalysisdatabasedesigncapacityplanningsqljavacledbaacle10gedprocedurescommercialmodelsagemanagementmetadatamanagementperfmancemanagement11gExperience: 4+ Years Work location: Hyderabad Notice Period: Strictly Immediate joiners to 20 days ONLY .net developer with database skills Data base skills ( Oracle 10g / 11g) . Interested candi...
netcomdesignsoftware11gdivreachaclesalaryresumedatabaseacle10gsoftwareservicesTechnology Exposure: Expertise in Oracle Forms & Reports and good Command of PL/ SQL Developers with 2-5 years of relevant experience in Oracle Forms & Reports / PL SQL programming can apply. Must...
sqld2klsqlaclecommandbusinessaclesqlacle10gacled2krepts6iaclef(2-5 years) Expertise in Oracle Forms Reports and good Command of PL/ SQL Job Profile Developers with 2-5 years of relevant experience in Oracle Forms Reports / PL SQL programming can apply. Must be...
sqld2klsqlaclecommandbusinessacle10gacled2krepts6id2krepaclefSupport Engineer- IT Industry Add to cart Job Title Support Engineer- IT Industry Language level English Industry Technology&Online Language level Japanese Sub- Industry Online B2C Services ...
troubleshootinglanoperatingsystemsswitchesmicrosoftsqlservermssqltestdatasqlserverwebservicesvisualstudiomicrosoftsqletwkingmssqlserveraclesqlacle10gservermanagementExperienceRole: Oracle DBAExp: 4 - 9 yrs;Location: ChennaiSkills specificationStrong experience in installations and configurations of Oracle 10g and 11g versionsPossess procedural skills to help desi...
datamodelingdatasecuritysystemanalysisdatabasedesignsqlcomjavaj2eedbmscledbaacle10gedprocedurescommercialmodelsagemanagementmetadatamanagementperfmancemanagement11gOracle PL SQL Oracle 10g Knowledge of both OS and Scripting Batch Scheduling tool e g Control M Knowledge of any automated deployment tool e g Ansibel Jenkins etc He She should also be aware of trou...
sqljenkinswebspherescriptingschedulingtroubleshootingdivaclecontrolacleplcontrolmacle10gcomponentsdeploymentRole Description : Provide detailed assessment of existing solutions and infrastructure to migrate to the cloud. Deliver migration strategy based on detailed analysis and implement application and dat...
applicationoperationsoutsourcingintegrationsystemhostingfusionmaintenanceadministrationmultiplecommunicationcledatabaseperfmancemanagementacle10gacleweblogic© 2019 Hireejobs All Rights Reserved