Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
Software Engineer, Drupal & Wordpress - Pepper Square Posted 2 weeks ago Software Engineer, Drupal & WordPress Experience: 3+ Years Develop and execute high performance, scalable websites using Drup...
lamp wordpress jquery drupal php avascript html5 webapplications webdevelopment javascriptjqueryExpert at HTML5/ JavaScript/ Angular JS/ Web Application Development Knowledge and experience on AngularJS is mandatory. Web Application Development in AngularJS at least 2 years Good knowledge in...
angularjs avascript webapplicationdevelopment html5Hands on experience in Java , Spring framework , JSF , PrimeFaces and avascript Should have very good working knowledge on RDBMS , SQL Working Knowledge on source control application (e.g. SVN ) Ja...
java mysql jsp hibernate spring unittesting softwaredevelopment jsf svn rdbms testing control software business analysts primefaces Moq pringframew rep ting Refact ingVery good experience in testing web frontend and/or web backend domain Very good experience in RESTful API Testing (Postman, SOAP-UI, Curl) Very good experience in Core Java programming to create Test...
eclipse java rest curl tdd ide avascript corejava restfulwebservices soaphttpBusiness Function description. This position is open under Products, R&D and Production business function. It plays an integral role in the life cycle of a product. While the department usually is s...
java agile xml json debugger framework scrum avascript game sqlplsqlConceptualizes and creates graphic user interface solutions for web sites and web application. The position will focus on user interface design. Candidates must be able to have a broad yet detailed ...
ajax ios xhtml css ui android avascript rubyonrails html5 webapplicationsTechnical Skills A Bachelor degree in Computer Science , or related field 7 years of shipping software experience Experience with SAAS and On Premise software Strong ability to design interfac...
git web framework js css3 angularjs ajax avascript html5 browserHead of UX and Design Looking a talented front-end UI/ UX developer to develop the front-end aspects of our products. Requirements B. Tech. / B. E / MCA degree in Computer Science, Engineering or a...
ajax xml mvc css json jquery avascript designpatterns html5We are looking for the MEAN Stack developer urgently for our projects with the details below. Minimum 2+ years of experience in MEAN technologies. Hands on experience in coding using Node.Js and Ex...
rest mongodb jquery mysql js sockets angularjs dojo avascript html5Experience building responsive websites using Drupal CMS, HTML / HTML5, CSS / CSS3, and JavaScript / jQuery Knowledge of PHP, PHP files and theme functions, and knowledge of the Drupal theme layer,...
cms css3 jquery php html css drupal avascript responsivedesign html5Should have good experience inSQLServerdatabase development Proficient inMSSQLServerand latest versions Expertise in T-SQL, stored procedures, user defined functions, triggers, joins, sub-queries etc....
communication triggers ms-dos programming software industry maintenance java dos t-sql application access asp.net sql design php avascript microsoftwindows communicationskills msasp mssqlserver windows98 network sqlserver softwaResponsibilities Writing reusable, testable, and efficient code Design and implementation of low-latency, high-availability, and performant applications Integration of user-facing elements developed b...
threading svn programming css3 git orm framework django avascript html5Job Role: Involvement in project requirement gathering, analysis & estimation Understanding project from team leader Planning modules development and deliveries with team leader Follow defined cod...
deployment net pms microsoft avascript if get project modules adonet
Job Description Our client is a leading Health care documentation solutions provider serving the U.S. healthcare market since last 45 years. Our client is looking for Interface Architect for Bangalo...
xsl hl7 interfaces sockets xml avascript applications computerprogramming mssqlYour main duties will be Oversee and administer the function of Consultants Procurement& Contract department. Involved in preparation of Tender Document for consultancy and construction packages in ...
taxation construction reports insurance compliance administration strategy procurement management commercial avascript computerinformationsciences contractmanagement claimsmanagement dataexchnageBusiness Function description. This position is open under Products, R&D and Production business function. It plays an integral role in the life cycle of a product. While the department usually is s...
java agile xml json debugger framework scrum avascript game sqlplsqlCross Platform Mobile Application Developer Description Designing and building advanced applications on HTML5 platform using Cordova or Intel XDK Work with HTML5 local database Collaborate with cro...
web jquery ui avascript javascriptjquery html5 applicationdevelopment responsivedesign mobileapplications developerAs a QA engineer, you will collaborate with developers and product managers to identify unambiguous software requirements, then develop and execute strategies to get that software into customer s hand...
openstack angularjs exceed retail sales sass git business js avascriptRequired Skills are:- java, advanced java, python, php,css, django, c++,swing, AWT. Also having basic knowledge about:- Bigdata, cloud computing, Machine learning....
jsp bigdata css basic java j2ee django swing hibernate php python avascript machinelearning advancedjava cloudcomputingRequired Skills are:- java, advanced java, python, php,css, django, c++,swing, AWT. Also having basic knowledge about:- Bigdata, cloud computing, Machine learning....
jsp bigdata css basic java j2ee django swing hibernate php python avascript machinelearning advancedjava cloudcomputingRequired Skills are:- java, advanced java, python, php,css, django, c++,swing, AWT. Also having basic knowledge about:- Bigdata, cloud computing, Machine learning....
jsp bigdata css basic java j2ee django swing hibernate php python avascript machinelearning advancedjava cloudcomputingRequired Skills are:- java, advanced java, python, php,css, django, c++,swing, AWT. Also having basic knowledge about:- Bigdata, cloud computing, Machine learning....
jsp bigdata css basic java j2ee django swing hibernate php python avascript machinelearning advancedjava cloudcomputingRequired Skills are:- java, advanced java, python, php,css, django, c++,swing, AWT. Also having basic knowledge about:- Bigdata, cloud computing, Machine learning....
jsp bigdata css basic java j2ee django swing hibernate php python avascript machinelearning advancedjava cloudcomputingRequired Skills are:- java, advanced java, python, php,css, django, c++,swing, AWT. Also having basic knowledge about:- Bigdata, cloud computing, Machine learning....
jsp bigdata css basic java j2ee django swing hibernate php python avascript machinelearning advancedjava cloudcomputingRequired Skills are:- java, advanced java, python, php,css, django, c++,swing, AWT. Also having basic knowledge about:- Bigdata, cloud computing, Machine learning....
jsp bigdata css basic java j2ee django swing hibernate php python avascript machinelearning advancedjava cloudcomputingRequired Skills are:- java, advanced java, python, php,css, django, c++,swing, AWT. Also having basic knowledge about:- Bigdata, cloud computing, Machine learning....
jsp bigdata css basic java j2ee django swing hibernate php python avascript machinelearning advancedjava cloudcomputingRequired Skills are:- java, advanced java, python, php,css, django, c++,swing, AWT. Also having basic knowledge about:- Bigdata, cloud computing, Machine learning....
jsp bigdata css basic java j2ee django swing hibernate php python avascript machinelearning advancedjava cloudcomputingAbout Accenture: Accenture Technology powers our clients businesses with innovative technologies established and emerging changing the way their people and customers experience work, life and entertai...
angularjs spring mysql avascript webservices restfulwebservicesMore than 3 years experience in web application development Good command over PHP, AJAX , JavaScript, HTML5, CSS, XHTML, JQuery, MySQL, CodeIgnitor. Strong knowledge of Design patterns Experienc...
xhtml css ui creativity jquery web avascript html5 webapplications paymentgatewayThe Ideal Candidate has: - Scaling and optimizing Node.js Applications - Working knowledge of Node-Sync, control Asynchronous behavior of Node functions. - Strongknowledge on ES6 (EcmaScript) or Ja...
node.js javascript node nosql avascriptHI, Greeting! Note:-We are having an interview schedule for coming Saturday 21 sept 2019. Hiring forData Science Engineer Location - Hyderabad Mandatory Skills - Javascript, Python, HTML, CSS, JQ...
avascript sql queries data manipulation data science api integrations phytonUrgent Requirement of IOS /ANDROID/ WINDOW Application Developer Company Name- One core Technologies Pvt. Ltd. Designation- Application Development (hybrid IONIC Framework) Experience- 1 Year 4 Yea...
php c++ json documentation ios framework javascript can css programming design java android avascript computerscienceWe are hiring for the profile of-Web Developer(PHP) for an IT company based in Delhi. The Job Details are mentioned below. - We are looking for a young, dynamic, energetic and career-oriented employ...
programming ajax css php mysql wordpress magento cakephp oops english software jquery cms avascript corephp webservices webdevelopmentdesign phase development phase mission phase should handle the app individually should know the API integration...
xml java sql avascript/jquery androidsdkandroidstudio restapiintegration. html/cssResponsibility Serve visitors by greeting, welcoming, directing and announcing them appropriately Answer, screen and forward any incoming phone calls while providing basic information when needed Rece...
java operations mail php filing faxing basic security avascript msoffice receptionist frontdeskPosition: SEO Executive Exp: Min 1 Year: Qualification: Any Graduate or MBA with hands on SEO CTC: 12K to 18K + Excellent Incentive Opportunity Job Location: Mumbai (C.S.T or Church gate 10 min wal...
research marketing avascript googleanalytics digitalmarketingHands on experience in Java , Spring framework , JSF , PrimeFaces and avascript Should have very good working knowledge on RDBMS , SQL Working Knowledge on source control application (e.g. SVN ) Ja...
java mysql jsp hibernate spring unittesting softwaredevelopment jsf svn rdbms testing control software business analysts primefaces Moq pringframew rep ting Refact ingAndroid Developers Exp - 6 months - 2 yrs Relevant experience in Android Apps development Solid understanding of full mobile development life cycle and experience with Android SDK, Java, Android Stu...
phpasp.netjavaavascriptJob Description Profound knowledge in graphics Able to make HTML5 and Responsive designs Sound knowledge in Macromedia Dreamweaver Good knowledge of XHTML, JavaScript, CSS Experience in logo desi...
dreamweaverhtmlcsswebxhtmlmacromediaavascriptwebsitedesigninghtml5responsivedesignBusiness Function description. This position is open under Products, R&D and Production business function. It plays an integral role in the life cycle of a product. While the department usually is s...
javaagilexmljsondebuggerframeworkscrumavascriptgamesqlplsqlThe role involves working on software design / development , maintenance and integration testing of routing protocols , management software and bringing up of Ethernet switch hardware with multiple p...
windowsmanagementc++mailsoftwarejavainstallationj2eetroubleshootingavascriptsoftwaredevelopingpatchmanagementmsofficeitoperationstechnicalhelpdesksoftwarequalitytestingtechnicalassistanceHello Everyone, NS internship programme 2019detail below. make it ready to market. Full training and development course along with industry standard IT project development experience. This is for t...
asp.netphpjavaavascriptreactjsangularjsPosition : Senior Python Developer Experience : 1-2 Years Salary : 4,00,000-6,00,000 LPA Location : Kakkanad, Kochi Job Summary : We are looking for a python developer to build our next generatio...
apisawspythonasp.netnextjavaphpavascriptmachinelearning. PHONEGAP DEVELOPER Education: MCA / B.E. / B. Tech. / B. Sc. Experience: 2 - 4 years of Experience. Key Words: Sr. Phonegap Developer - Jobs, Bangalore / Bengaluru, Mobile Technologies, Phon...
qualitybootstraphtmljavascriptjavacomapplicationjqueryasp.netphpanalyticssystemsavascriptwebservicesmobileapplicationWith Java Script , React JS exp with 1-4years of experience We have built an ambitious product in the Ecommerce industry that is already live in its initial version. Think of it as Shopify b...
node.jsreact.jsavascriptes7reduxDescription We are looking for creative, technical problem solvers to join our professional services team. Join us and work on the leading edge of the Robotic Process Automation movement. Our produc...
htmljqueryajaxbootstrapphpxmlmysqlcssavascriptdesignpatternsPrimary Skill: Salesforce with Lighting 5+ years of total IT experience with minimum 3 years of experience in Salesforce Minimum 2 project implementations in lightning. Expertise in developing ligh...
functionalasp.netjavasalesforcephpc++avascriptDear Aspiring Candidate, GREETINGS! We, 4Ds inc, are a leading IT Recruitment Consulting firm, having Office at Ahmedabad. We partner with and provide services to Indian and Multinational Corporate...
avascriptmysqlecommercemagento backendseo practicesmagento 2.2magentofrontendResponsibilities
© 2019 Hireejobs All Rights Reserved