Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
Designation - Full Stack Developer - (1 position) Skills Required a) 3+ years as a software developer with experience developing responsive, single page web applications using JavaScript, Java, HTML5,...
asa client javascript ramew responsivedesign applications page developer fullUser Interface Development Professionals with hands on experience in Angular.JS, Node.JS, Backbone.JS, Bootstrap to develop state of the art, responsive, aesthetic UI and visualizations for big data ...
css3 bootstrap art jquery js tml5 javascript responsivedesign userinterfaceGraphic Web Designer Exp - 2+ yrs Location - Kolkata, India View Job Description Graphics and Web Designer Key Skills: Website Layout Design UI Design for mobile Knowledge of HTML, XHTML, HTML5, C...
jquery mobile xhtml css3 ui html tml5 websitedesigning responsivedesign uidesignMumbai (India) - Require freelance website designer cum responsive html5 developer We have require experience freelance web designer cum responsive html5 developer who can provide very creative desig...
web technology design esponsive creativedesigning websitedesigning designer developer responsivedesign html5
Software Engineers at Endurance develop engaging, responsive, scalable reliable web services and web-presence products for our 4+ million subscriber base. At Endurance, we build the web. Our produ...
applicationtesting ruby web java webapplications webservices cms php oaphttp responsivedesignDesignation - Full Stack Developer - (1 position) Skills Required a) 3+ years as a software developer with experience developing responsive, single page web applications using JavaScript, Java, HTML5,...
asa client javascript ramew responsivedesign applications page developer fullWindows App Developer Experience of Object - Oriented programmingassociated design patterns. Have developed at least 3 Windows mobile application 8.110. Must know Windows app store proceduresex...
mobileapplications apps mobileapplicationdevelopment mail json development pp responsivedesign so websiteJOB KRAS: Should be familiar with the HTML and CSS, Responsive WP Themes. Able to develop the high performance, scalable and custom based WordPress sites. Build the websites, prototypes and applica...
mysql css development well xhtml resolution pplications motivator responsivedesign websiteMumbai (India) - Require freelance website designer cum responsive html5 developer We have require experience freelance web designer cum responsive html5 developer who can provide very creative desig...
web technology design esponsive creativedesigning websitedesigning designer developer responsivedesign html5Graphic Web Designer Exp - 2+ yrs Location - Kolkata, India View Job Description Graphics and Web Designer Key Skills: Website Layout Design UI Design for mobile Knowledge of HTML, XHTML, HTML5, C...
jquery mobile xhtml css3 ui html tml5 websitedesigning responsivedesign uidesign
Software Engineers at Endurance develop engaging, responsive, scalable reliable web services and web-presence products for our 4+ million subscriber base. At Endurance, we build the web. Our produ...
applicationtesting ruby web java webapplications webservices cms php oaphttp responsivedesignJob Description Profound knowledge in graphics Able to make HTML5 and Responsive designs Sound knowledge in Macromedia Dreamweaver Good knowledge of XHTML, JavaScript, CSS Experience in logo desi...
dreamweaver html css web xhtml macromedia avascript websitedesigning html5 responsivedesignDesignation - Full Stack Developer - (1 position) Skills Required a) 3+ years as a software developer with experience developing responsive, single page web applications using JavaScript, Java, HTML5,...
asa client javascript ramew responsivedesign applications page developer full
Job For Junior Software Engineer in Ahmedabad
Reputed IT Company Requires Junior Software Engineer
Responsibilities:
->Designed, developed and con...
java webapplications designpatterns javascript js webdevelopment cms oftwareengineer responsivedesign framew ksWeb Designer 2+ Yrs Experience Front End Creative Responsive Web Design using Wordpress, CMS, Html5, CSS, JS, Know More.,...
web cms design css wordpress js ebsitedesigning frontend responsivedesign html5User Interface Development Professionals with hands on experience in Angular.JS, Node.JS, Backbone.JS, Bootstrap to develop state of the art, responsive, aesthetic UI and visualizations for big data ...
css3 bootstrap art jquery js tml5 javascript responsivedesign userinterfaceDesign , code , test and debug new features and enhancement to Flytxt products over Big Data platform following best practices of agile software development Take advantage of new technologies and tech...
xml mobile ajax rest mysql eclipse json java soaphttp responsivedesignSr. UI Developer, Should have over 7 years of experience in Information Technology. Key Responsibilities Will work independently to deliver on client requirements on UI related tasks. Will parti...
adobe w3c css bootstrap css3 ebsitedesigning responsivedesign uiprogramming html5Web Designer 2+ Yrs Experience Front End Creative Responsive Web Design using Wordpress, CMS, Html5, CSS, JS, Know More.,...
web cms design css wordpress js ebsitedesigning frontend responsivedesign html5Web Designer Minimum Experience : 1 year Knowledge : Photoshop, Corel Draw, HTML5, CSS3, JavaScript, Bootstrap, Responsive,...
web photoshop bootstrap css3 esigner html5 javascript websitedesigning coreldraw responsivedesignGraphic Web Designer Exp - 2+ yrs Location - Kolkata, India View Job Description Graphics and Web Designer Key Skills: Website Layout Design UI Design for mobile Knowledge of HTML, XHTML, HTML5, C...
jquery mobile xhtml css3 ui html tml5 websitedesigning responsivedesign uidesign
User Interface Development Professionals with hands on experience in Angular.JS, Node.JS, Backbone.JS, Bootstrap to develop state of the art, responsive, aesthetic UI and visualizations for big data ...
css3 bootstrap art jquery js tml5 javascript responsivedesign userinterfaceCandidate should be graduate or above and having 1 year of experience in same field.
Candidate should have 1 to 2 years of experience in same field.
Designation - Full Stack Developer - (1 position) Skills Required a) 3+ years as a software developer with experience developing responsive, single page web applications using JavaScript, Java, HTML5,...
asa client javascript ramew responsivedesign applications page developer fullExperience building responsive websites using Drupal CMS, HTML / HTML5, CSS / CSS3, and JavaScript / jQuery Knowledge of PHP, PHP files and theme functions, and knowledge of the Drupal theme layer,...
cms css3 jquery php html css drupal avascript responsivedesign html5Technical Architect will be the first level of technical point of contact for the team on Drupal issues & problems. Drupal Architect | TA Digital Job Description Description Technical Architect wi...
technicalarchitecture computerprogramming api svn git versioncontrol designpatterns drupal responsivedesignCross Platform Mobile Application Developer Description Designing and building advanced applications on HTML5 platform using Cordova or Intel XDK Work with HTML5 local database Collaborate with cro...
web jquery ui avascript javascriptjquery html5 applicationdevelopment responsivedesign mobileapplications developerMake the changes, be a part of our family, explore and evolve with new technical expertise. Software Development Professionals Fullstack Kolkata |Full Time Experience in HTML and NodeJS and Typescri...
computer verbalcommunication development domain ptitude big framew responsivedesign btech technicalsuppPosition :Seniordesignengineer Location :Hyderabad Vacancy : 2 Experience : 4 to 7 years (Must be in E-commerce company) experience in any other industry will not be counted Candidates must have:-...
linux javac++ unixTechnical Architect will be the first level of technical point of contact for the team on Drupal issues & problems. Drupal Architect | TA Digital Job Description Description Technical Architect wi...
technicalarchitecture computerprogramming api svn git versioncontrol designpatterns drupal responsivedesignUser Interface DeveloperInformation Systems Gurgaon , Gurgaon DescriptionCompany Summary : Trek Bicycle is a global leader in the design and manufacture of bicycles and related products. Trek belie...
animation javascript ui html ux cms css serinterface responsivedesignWindows App Developer Experience of Object - Oriented programmingassociated design patterns. Have developed at least 3 Windows mobile application 8.110. Must know Windows app store proceduresex...
mobileapplications apps mobileapplicationdevelopment mail json development pp responsivedesign so websiteDesignation - Full Stack Developer - (1 position) Skills Required a) 3+ years as a software developer with experience developing responsive, single page web applications using JavaScript, Java, HTML5,...
asa client javascript ramew responsivedesign applications page developer fullJob Profile:
strong in FRONTEND UI DEV using HTML, CSS, JS, Reach, redux, knockout very strong in responsive web designing, semantic type HTML. if any exp in Reactjs/E-commerce projects it would be added E-COM EXP...
webcomdivfrontenddevresponsivedesignJob Description Profound knowledge in graphics Able to make HTML5 and Responsive designs Sound knowledge in Macromedia Dreamweaver Good knowledge of XHTML, JavaScript, CSS Experience in logo desi...
dreamweaverhtmlcsswebxhtmlmacromediaavascriptwebsitedesigninghtml5responsivedesignPosition - Sr. Web Developer Duties & Responsibility:- Identify user and system requirements for new websites and applications Prioritize software development projects, set timelines and assign ta...
navigationprototypingcsswireframesraphicdesignhtml5cssjavascriptresponsivedesignAt NTT DATA Services, we know that with the right people on board, anything is possible. The quality, integrity, and commitment of our employees are key factors in our company s growth, market presenc...
sasscssjqueryhtmlompatibilityresponsivedesignhtml5Candidate should have 1 to 2 years of experience in same field.
Candidate should be graduate or above and having 1 year of experience in same field.
© 2019 Hireejobs All Rights Reserved