Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
Nokia is a global leader in the technologies that connect people and things. With state-of-the-art software, hardware and services for any type of network, Nokia is uniquely positioned to help communi...
problem solvingweb servicesfront endhigh pressuresublime texttime managementext jsemail serverbeyond compareLooking for React JS developer for an AI assisted analytics company Experience : Min 2 years . Skills required :Must have experience working on
As a global leader in assurance, tax, transaction and advisory services, we hire and develop the most passionate people in their field to help build a better working world. This starts with a culture ...
ms sqlfront enddata gridsupply chainsales growthdata analyticsui developmentbusiness designmachine learningfinance functionadvisory servicesAs a global leader in assurance, tax, transaction and advisory services, we hire and develop the most passionate people in their field to help build a better working world. This starts with a culture ...
sqljavacustomer relationssapdocumentationms sqlfront enddata gridsupply chainsales growthdata analyticsui developmentbusiness designmachine learningfinance functionadvisory servicesAs a global leader in assurance, tax, transaction and advisory services, we hire and develop the most passionate people in their field to help build a better working world. This starts with a culture ...
sapcustomer relationsdeliverysalessqlms sqlfront enddata gridsupply chainsales growthdata analyticsui developmentbusiness designCan - do attitude, Innovative Technocrat, Quick learner and Looking for the next level of career growth – does it sound like you? We have opening for Software engineers experienced between 0 - ...
Angular: Web technologies HTML5 / CSS3 / JavaScript JQuery and AJAX Thorough knowledge of OOPs. Should be comfortable with TypeScript Language. Knowledge on Design patterns Dependency Injection Digest / Change cycle. Familiar with external JavaScript LDear Job Seeker, Currently, We are looking for the Senior Engineer & Team Lead (PHP Designer & Developer)in Bangalore. Designation / Position: Senior Engineer & Tea...
equipment supplyphpoptimization strategiesquery writingtime seriesagile methodologyfinancial servicesnetwork managementmanagement systemcssmaxhtmljirafinding opportunitiesnetwork management systemproject administrationmapfoodAs a global leader in assurance, tax, transaction and advisory services, we hire and develop the most passionate people in their field to help build a better working world. This starts with a culture ...
financesalesltdmisaccountancyms sqlfront enddata gridsupply chainsales growthdata analyticsui developmentbusiness designAbout Accenture: Accenture is a leading global professional services company, providing a broad range of services in strategy and consulting, interactive, technology and operations, w...
javajavascriptsqlcustomer relationshtmlresearchdevelopmentfront endmusic makingbusiness processsoftware engineeringprofessional servicesemerging technologies
Desired Candidate Profile: o10 years of experience in architecting, designing and development in relevant technical/domain. With prior experience in managing large projects and key solution assets / ...
awsnet frameworktechnology evaluation web services sqljava iosdeliveryVirsec is looking for a Senior Software/ Software Engineer with UI & Java skills Do you see yourself in a role that will help reshape the world of cyber securityWe re building the future of cyber secu...
javasql javascriptsql server jqueryjava ee front endspring boot web servicescyber secuVirsec is looking for a Senior Software/ Software Engineer with UI & Java skills Do you see yourself in a role that will help reshape the world of cyber securityWe re building the future of cyber secu...
javasql javascriptsql server jqueryjava ee front endspring boot web servicescyber secuApply Telephonic Interview followed by SkypeInterview from American Head Office (Chicago) and finally Personal Interview Can apply directly at (hr.plnr@gmail.com) NO WALKINS Job Location:Prahladnag...
nodeasp.net java angular jsnode.js phpjava script
should posses the below mentioned skills
Full stack - Very must Angular, javascript
Anyone backend - Java, Python,Nodejs,Php
Anyone Database - SQL,Mysql,Postgress, Mon...
6.0 Year(s) To 10.0 Year(s) The following is the job description and specs for the position. Experience : 6- 10 years Budget : 8- 20 lacs ( differs based on experience) Position B.E. (Or equivale...
pplication development design patterns level design security management aspnet mvc information security management music making analytical skills tec flow charts it services low level design information securityDear Candidate Job Responsibilities:
Thirdware Solution Limited is a multinational IT Business and Consulting Company in Enterprise Application Space (EAS) is recruiting UI Developer. *** Candidate has to take up online coding test (Hac...
restcomltdhtmlcssajaxoopsapieasumlExcellent Object Oriented Programming Skills in C#. Hands-on Experience in ASP.Net Web API, ASP.Net MVC. HTML5, Bootstrap, CSS. Angular 5. Excellent skills of SQL Query Writing. Basic understandi...
basicnetsqlmvcapitfswritingaspcss.netasp.netbootstrapueryhtml5© 2019 Hireejobs All Rights Reserved