Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
Expert in designing and developing Scorecards, Dashboard Analysis and Reports in Tableau Should have strong knowledge of full UI development life cycle including Design, Development, Debugging, Testi...
sqlserver java sql customerrelations javascript bigdata lifecycle datamodeling uidevelopment problemsolving businessintelligence writtencommunication ui sap etl db2 api fact mysql clesqlPLSQL_6-9Years_Chennai Qualifications Job Responsibilities JOB DESCRIPTION:
You will work effectively individually and with team members toward customer satisfaction and success You will assist in creating solutions for client and/or internal review Participate in client meet...
databases sqlserver sql databaseadministration rman businessprocessmanagement weblogic servicelines updatemanager weblogicserver clesqlJobDescription : S&P Global Ratings The Role : Software Engineer. Grade : 8A. The Location : Hyderabad. The Team : Content publishing is team within S&P Global Ratings Technology. Content ...
mssql creditrisk buildtools unittesting globalteams softwarebuild versioncontrol qualityassurance structuredfinance digitalconversion clesql microsoftw financialsectproductionsuppPosted on June 30, 2017 Sr. Java Developer | JRD Systems Sr. Java Developer Full Time Posted on June 30, 2017 JRD Systems Job Description Must be a self- motivated developer who can get the job ...
java mysql jsp hibernate spring shellscripting agilemethodology cv sql unix rest agile email design struts jasper resume command clesql acleINFORMATION We are currently looking for a Web Developer/ PHP Developer with below mentioned skills: Experience the freedom of building custom web sites using your own leadership. Keyskills: C, Ja...
mysql php jquery javascript html webservices webtechnologies webapplications websitedesigning websitedevelopment sql css java linux WindowsCommunicationFoundation SOAP JavaMessageService clesql acleWe are currently looking for a Web Developer / PHP Developer with below mentioned skills: Experience the freedom of building custom web sites using your own leadership. Keyskills: C , Java , Php , Ht...
css html javascript jquery mysql webservices webtechnologies webapplications websitedesigning websitedevelopment php sql java linux WindowsCommunicationFoundation SOAP JavaMessageService clesql aclePosted on June 30, 2017 Sr. Java Developer | JRD Systems Sr. Java Developer Full Time Posted on June 30, 2017 JRD Systems Job Description Must be a self- motivated developer who can get the job ...
javamysqljsphibernatespringshellscriptingagilemethodologysqlunixrestagileemaildesignstrutsjasperresumecommandclesqlacleTechnical Lead - Java Technical Lead - Java Must be able to play leadership role with virtually no supervision. The role requires 80% hands on technical responsibility and 20% team co-ordination re...
javaenvironmentsqlserversqlcustomerrelationswebservicesdesignpatternsejbj2eeoopsooadrestdesignspringbankinglendinghibernateclesqlteamcodinationacle
Find Job Job Position : Sr. SQL Developer Oracle 11.2 version OCP 11.2 certified/ OCE 11.2 certified Only need Oracle SQL Developer Secondary experience on Data warehouse Secondary experience ...
sqlsqlserverssisssrsdatabaseadministrationocpsalaryPLSQLXMLSQLServerIntegrationServicesLoadclesqlacleperfmanceTransactSQLExtractTransfSQLServerReptingServicesNETFramewExperience: 2 - 4 years , Job Location: Chennai Collaborate with Operation team and developers to produce software designs Formulate program specifications and basic prototypes Transform software ...
relationaldatabasessqlitesbasicvbnetsoftwaredatabasesclesqloperationteamcriticalthinkingsoftwaresolutionsprojectadministrationacleanalyticalspecificationsSocialPerceptivenessOperationMonitoAs a Senior Software in Thales, Noida, you will you will conduct complex software product research leading to new or improved products to maintain the company s competitive position and profitability....
javasqljavascriptsqlserverjqueryresearchdevelopmentclesqlBuild a data platform to support Asset Management s data analytics and discovery needs. If you have a passion for working with data using multiple emerging technologies on the cloud, this might be the...
javasqljavascriptsqlserverjquerytestautomationtoolssubjectmatterexpertiselowlatencymusicmakingdataanalyticsequitytradingdesignpatternshighthroughputtestautomationclesqlAb initio Developer.4 years.Ab Initio GDE Ab Initio Co-OS Oracle SQL and Unix.Ab initio.1. Minimum 4 years of Total IT experience and 3 years of experience in ETL-Ab Initio. 2. Proven development expe...
javasqljavascriptsqlserverjqueryabinitioissueresolutionpdlunixclesqlkingexperienceKey skills required for the job are:
Skills specification Experience in Providing L1 Application support Experience in documenting L1 task and to be performed on routine basis. Knowledge in database or Data Migration/ Data base Tra...
sqlunixlinuxsqlservertroubleshootingdatamigrationerpjavanicewindowscommunicationclesqlapplicationsuppcompaclebusinessdatabaseholidaysnetwkingOracle SQL SQL developer to develop MS-SQL queries and procedures, You will be responsible for designing databases and ensuring their stability, reliability and performance. , Roles & Responsibilitie...
unixshellscriptingshellscriptingdatabasedevelopmentperlunixdatabasedatabasesclesql5 Years of strong knowledge on Unix Operating System. Expertise in shell scripting in various shells. Expertise in unix commands cut , grep , find , Chmod etc. Expertise in scheduling through Cr...
salesmisaccountstatbankingconnectdirectshellscriptingsqlftpawksedunixnicegrepscriptinganalyticalschedulingclesqlacleperfmanceShort Description PL SQL_4 6 Years_Pune Qualifications Job Responsibilities JOB DESCRIPTION:
Lead Consultant JD : Experience in Oracle SQL, PL/SQL for a minimum of 7 years Adept in creating procedures, functions, packages, Dynamic SQL, triggers, Collections, Bulk processing using PL/SQL Exper...
sapenvironmentdeliverycustomerrelationssalescommunicationskillssqlplsqlcollectionscommunicationPLSQLXMLSQLServerIntegrationServicesLoadclesqlacleTransactSQLExtractTransfSQLServerROracle Fusion - SOA, BPEL Demonstrable experience in developing largescale enterpriseclass database applications using Oracle PL/SQL. Excellent Oracle SQL and PL/SQL skills and a passion for data anal...
bigdataproblemsolvingagiledevelopmententerprisesoftwaresoftwaredevelopmentdatabaseapplicationsapplicationdevelopmentsqlperlunixcloudagiletestspythonplsqlwritingsoftwareclesqlacleYou will design, develop, modify, debug and /or maintain software code according to functional, non- functional and technical design specifications. You will follow Amdocs software engineering standa...
sqlserversqlssisssrsetlsolutiondesigncomputersciencetechnicaldesignsoftwaredevelopmentsoftwareengineeringindustrialengineeringconticlesqlreptingtooltechnicalsuppinfmationsystemYou will have the opportunity to reflect customer needs by gathering business documents and technical requirements. You will be a key advisor for customers based on product capabilities and best prac...
customerrelationsdocumentationrequirementsfunctionalbusinessrequirementscomputersciencebusinessanalysisindustrialengineeringsqletlepcfitsfdcagileclesqlreptingtoolinfmationsystemreusWork Based Competencies Required: Mandatory 4 to 6 years hands-on experience in Java, J2EE, Spring, Hibernate In-depth knowledge on Angular, Node and Jasmin, Karma and Protector testing framework. ...
javascriptcssjqueryhtmlmysqlmusicmakingversioncontrolfunctionaltestingsqlgitjavaj2eenicejunitkarmaspecscreditdevopsclesqlacleTechnical Leader Your work will have an immediate influence on day- to- day decision making and the adoption of new Business Intelligence technologies. You will be challenged with a variety of tasks,...
javaenvironmentsqlserversqlcustomerrelationsbigdatanewbusinessdatasecuritydatagovernancedatawarehousingdataengineeringbusinessintelligenceoperationalexcellenceclesqldatatransfmationTechnical Leader Your work will have an immediate influence on day- to- day decision making and the adoption of new Business Intelligence technologies. You will be challenged with a variety of tasks,...
javaenvironmentsqlserversqlcustomerrelationsbigdatanewbusinessdatasecuritydatagovernancedatawarehousingdataengineeringbusinessintelligenceoperationalexcellenceclesqldatatransfmationTechnical Leader Your work will have an immediate influence on day- to- day decision making and the adoption of new Business Intelligence technologies. You will be challenged with a variety of tasks,...
javaenvironmentsqlserversqlcustomerrelationsbigdatanewbusinessdatasecuritydatagovernancedatawarehousingdataengineeringbusinessintelligenceoperationalexcellenceclesqldatatransfmationTechnical Leader Your work will have an immediate influence on day- to- day decision making and the adoption of new Business Intelligence technologies. You will be challenged with a variety of tasks,...
javaenvironmentsqlserversqlcustomerrelationsbigdatanewbusinessdatasecuritydatagovernancedatawarehousingdataengineeringbusinessintelligenceoperationalexcellenceclesqldatatransfmationVery strong RDBMS and PL/ SQL development experience in Forms and Reports with Banganking or Finance domain, With excellent Communication skills mandatory Skills Required : Oracle PL/ SQL with Forms a...
javasqljavascriptsqlserverjqueryunixshellscriptingshellscriptingsqldevelopmentcommunicationskillssoftwareengineeringunixrdbmsclesqleducationalqualificationprocplsqlprocaclefina5+ Years of Oracle Development Experience Strong knowledge of Oracle SQL, PL/SQL Working experience in Oracle Forms Development (D2K 12 C) Good Communication Skills Shift Timing 2 PM to 11 PM Sal...
sqltimingsoftwarecommunicationOracleDesignerOracleDeveloperSuiteclesqlaclefmsdevelopmentacledevelopmentkingexperienceacleOracleReptBuilderOAFramewOracleRepThe Skills that are Key to this role You are Involved in development and delivery of high quality, timely and maintainable software solutions in an Agile environment which meet functional and non-fu...
jqueryjavamvcsqlservercustomerrelationstestautomationtoolssubjectmatterexpertiselowlatencymusicmakingdesignpatternshighthroughputtestautomationassetmanagementclesqlspringframewThe Skills that are Key to this role You are Involved in development and delivery of high quality, timely and maintainable software solutions in an Agile environment which meet functional and non-fu...
jqueryjavamvcsqlservercustomerrelationstestautomationtoolssubjectmatterexpertiselowlatencymusicmakingdesignpatternshighthroughputtestautomationassetmanagementclesqlspringframew1. Minimum of 4-12 years of development experience in Oracle E-Biz applications and minimum of 3 years of experience in Oracle R12 version or higher 2. Experience in Implementation, Design, Developme...
xmlpublishertechnicaldesigninterfacedesignsqlxmlr12hrmsclesqlaclehrmsaclerepaclefinancialsdesigndevelopmentdevelopmenttestingcomponentinterfaceacler12plsqlExperience: 2 - 4 years , Job Location: Chennai Collaborate with Operation team and developers to produce software designs Formulate program specifications and basic prototypes Transform software ...
relationaldatabasessqlitesbasicvbnetsoftwaredatabasesclesqloperationteamcriticalthinkingsoftwaresolutionsprojectadministrationacleanalyticalspecificationsSocialPerceptivenessOperationMonito
Production Support Engineer, Experience in resolving critical incidents. Experiance in go live activities. ITIL Certified and having minimum basic experience. Rotational shifts to be worked, e...
unixsqlshellscriptingslatroubleshootingclientmanagementxmlitilhtmllinuxbasicmanagementclesqlitilcertifiedproductionsuppexecutiveproductionaclebusinessExperienceRole: L1 Application Support EngineerExp: 2- 5yrs;Work Location: ChennaiSkills specificationExperience in Providing L1 Application supportExperience in documenting L1 task and to be performe...
sqlunixlinuxsqlservertroubleshootingdatamigrationerpcomjavanicewindowsclesqlnetwksuppapplicationsuppcompacleresumedatabaseholidaysJob Role: Informatica Production Support
Extensive Knowledge of PHP5, MYSQL, oracle, HTML, JavaScript, JQuery, Ajax, CSS3, Bootstrap, Media Query, Joomla, Magento, LAMP, ubuntu, linux, GIT, Bitbucket, Agile methodology and development, ecomm...
mysqlphpjqueryjavascripthtmlserversideprogrammingvisualstudioproblemsolvingsqlcssgitunixajaxlampclesqlwebserverserversideclientsideagilemethodologyAbout Accenture: Accenture Technology powers our clients businesses with innovative technologies established and emerging changing the way their people and customers experience work, life and e...
sqlserverdatamodelingdefecttrackingtestautomationbusinessprocesscommunicationskillsclesqlcomplexsystemsbuildautomationagilemethodologytechnologyplatf
Telecom Engg- Good understanding of Charging and rating system, preferably Huawei system Have experience in roaming module of IN IN Experience with minimum of 3 to 4 years. Good in Basic Technical...
sqlunixbasicclesqltechnicalskillsacleroamingchargingLearnabilityBusinessSavvyInternetSavvyGraspNewConceptsQuicklyQuickWittedTactfulnessQuickGraspingKnowledgehungryLearnerOrganizationalCommitmentPLSQ1. 4 - 7 years of experience with Java , J2EE Production Support. 2. Strong hands on experience in Java / J2EE (Servlets , JSP) , Unix 3. Strong hands on experience in SQL & PL/SQL 4. Working Experie...
javaservletsjspj2eewebsphereweblogicclesqlproductionsupp© 2019 Hireejobs All Rights Reserved