educational strategies jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

educational strategies Job Openings

Showing 24251 - 24300 of 29529 Jobs

Senior Study Abroad Advisor

IRISH EXPERT LLP 1.00 to 6.00 Years Bangalore 01 Apr, 2024

Senior Study Abroad Advisor

Role Summary

overseas education

service sales

Data Analyst (Power BI, Python, SQL)- Internal Audit domain, Bangalore

Talent Leads HR Solutions Pvt Ltd 3.00 to 8.00 Years Bangalore 01 Apr, 2024

Qualification- Mba Finance / Mca

Experience 3 years

Location Bangalore BO.

5.5 Days working from Office

Key responsib...
sqlpowerdata analysisdatapython

Electronics Design Engineer
Spotlight Recruitment Services 0.00 to 1.00 Years Bangalore 01 Apr, 2024

We have an urgent hiring forMechanical Engineer Civil Engineer Electrical Engineer Automobile Engineer Candidate Profile: Age: Between 18 and35 years Educational Qualification: HSC (102) & ab...
automobilecivil engineering

Marketing Manager
MILLENNIUM BABYCARES PRIVATE LIMITED 13.00 to 23.00 Years Bangalore 01 Apr, 2024

An Email Marketing Manager utilizes email communication tools to market a company and increase brand awareness. They are experts in the usage of email communications and develop marketing strateg...
marketservicemarketinganalyticscampaignspowerpointcustomerresearchmanagementdigitalprojectntegratedstrong

Civil Site Engineer
Spotlight Recruitment Services 1.00 to 0.00 Years Bangalore 01 Apr, 2024

We have an urgent hiring forMechanical Engineer Civil Engineer Electrical Engineer Automobile Engineer Candidate Profile: Age: Between 18 and35 years Educational Qualificati...
automobilecivil engineering

Training Placement Officer
SKIPS University 5.00 to 9.00 Years Ahmedabad 01 Apr, 2024

Position Overview: As a Training and Placement Officer will play a pivotal role in connecting students with career opportunities by facilitating Students training, skill development, and eventual...
Strong communication skillsData managementStakeholder engagementDatabase managementNetworking abilitiesUnderstanding of student needsindustry requirementsCareer counselingMicrosoft Office SuiteKnowledge of industry trends

Executive Assistant
Rao Consultants 2.00 to 6.00 Years Ahmedabad 01 Apr, 2024

Company Description Rao Consultants is a leading visa consulting company based in Ahmedabad, Gujarat. With over 20 years of experience, Rao Consultants is dedicated to helping individuals achieve...
Executive Administrative AssistanceExpense ReportsExecutive SupportStrong Communication skillsAdministrative AssistanceExcellent organizationalmultitasking abilitiesAbility to maintain confidentialityProficient in Microsoft Office SuiteExperience

Teacher in D.A.V. School
RENOVISION TECHNOLOGY 0.00 to 1.00 Years Ahmedabad 01 Apr, 2024

Classroom teachers will be expected to:

have the content knowledge and pedagogical practice to meet the diverse needs of all students teacher trainingeducation policystudent disciplinecharter schoolsschool boards

Admission Counsellor (Female) - GD Goenka International School ...
Sankalp Group 2.00 to 6.00 Years Ahmedabad 01 Apr, 2024

An opportunity to work with The Sankalp Group assures you more than just job satisfaction, it inculcates a sense of diversity and humanitarian values needed to function in a hospitality sector. S...
Admission CounsellingResearchVerificationCoordinationInterviewingRecruitmentApplication ReviewFollowup

Lead - Talent Management
Adani Group 15.00 to 19.00 Years Ahmedabad 01 Apr, 2024

Purpose of the role:- Reporting to the Group Head, Talent and Leadership Development, the Succession Planning & Assessment Leader will be responsible for developing a pipeline of ready-to-deploy,...
Succession PlanningTalent ManagementLeadership DevelopmentOrganizational PsychologyChange ManagementTalent Assessment

Business Head
Gallops group 10.00 to 14.00 Years Ahmedabad 01 Apr, 2024

Company Description We suggest you enter details here. Role Description This is a full-time on-site role located in Ahmedabad for a Business Head in Automobile Dealership. The Business Head ...
SalesMarketingFinanceInventory ManagementCustomer ServiceBusiness GrowthRelationship BuildingCustomer SatisfactionLeadershipNegotiationAutomotive Market KnowledgeFinanceBudgeting

Talent Acquisition Manager
Bethel Group 5.00 to 9.00 Years Ahmedabad 01 Apr, 2024

Bethel Group is looking to hire for a *Talent Acquisition Manager* role for one of the leading luxury automobile brand. Job Location - Ahmedabad, Gujarat Budget - Upto 11 lpa Responsibilities: ...
Talent AcquisitionRecruitmentManpower PlanningSuccession PlanningSourcingInterviewingCandidate AssessmentCommunication SkillsNegotiation SkillsInterpersonal SkillsTeam HandlingTalent Pipeline ManagementRecruitment Process ImprovementIndustry

Assistant Manager Business Development
Unison Globus 3.00 to 7.00 Years Ahmedabad 01 Apr, 2024

Company Description Unison Globus is a Florida-based company that has been catering to the needs of CPAs, EA, and Accounting professionals in North America, Australia, New Zealand, and Singapore ...
Business DevelopmentSalesClient Relationship ManagementAccount ManagementCommunicationInterpersonal SkillsAnalytical SkillsMicrosoft OfficeProblemSolving SkillsFinancial KnowledgeAccounting KnowledgeTax Preparation Services

Mechanical Production Engineer
Spotlight Recruitment Services 0.00 to 1.00 Years Vellore 30 Mar, 2024

We have an urgent hiring forMechanical Engineer Civil Engineer Electrical Engineer Automobile Engineer Candidate Profile: Age: Between 18 and35 years Educational Qualification: HSC (102) & ab...
automobilemechanical maintenance

Business Analyst Urgent Vacancy
RENUKA INTERPRISES 0.00 to 4.00 Years Vellore 30 Mar, 2024

We are hiring a business analyst to join our project team. You will work alongside other business analysts and report directly to the project manager. Your main tasks will include performing deta...
analysisdata analysissqlbusiness analysis

Hiring For Business Analyst
Divya Staffing Solution 0.00 to 4.00 Years Vellore 30 Mar, 2024

We are hiring a business analyst to join our project team. You will work alongside other business analysts and report directly to the project manager. Your main tasks will include performing deta...
project managementbusiness processsoftware testingdata analytics

Business Analyst Opening
Divya Staffing Solution 0.00 to 4.00 Years Vellore 30 Mar, 2024

We are hiring a business analyst to join our project team. You will work alongside other business analysts and report directly to the project manager. Your main tasks will include performing deta...
business processdata analyticssoftware testingproject management

Assistant Manager
Contrywide 3.00 to 5.00 Years Varanasi 30 Mar, 2024

Company Description We suggest you enter details here. Role Description This is a full-time on-site role for an Assistant Manager located in Varanasi. The Assistant Manager will be responsible ...
CommunicationInterpersonal skillsCritical thinkingMicrosoft OfficeProject managementTeam managementCollaborationStrong leadershipProblemsolvingDecisionmakingOrganizational skills

Academic Content Expert - Chemistry(English)
QA solvers 3.00 to 7.00 Years Varanasi 30 Mar, 2024

Key Responsibilities Working on digital projects meant to cater to the K-20 segment Reviewing/Creating text and video content in English Providing quality content for 11-12th/NEET/JEE-mains/JEE...
Content creationEnglishChemistryDigital projectsAcademic content

Territory Growth Manager
Ashirvad Pipes 3.00 to 7.00 Years Varanasi 30 Mar, 2024

Role Purpose: Responsible for managing sales of Ashirvads products in the defined geographic area and ensure consistent, profitable growth in sales revenues. Identify objectives, strategies and a...
Sales PlanningSales ExecutionSales StrategiesMarket AnalysisNegotiationChannel DevelopmentMarketing InitiativesTrade Promotion

Marketing Manager
IMS Learning Resources Pvt Ltd 3.00 to 7.00 Years Varanasi 30 Mar, 2024

Company Description IMS Learning Resources Pvt. Ltd. is a pioneering institution in management education training in India. Established in 1977, IMS has expanded into various sectors, providing t...
Market researchAnalytical skillsCommunication skillsProject managementDigital marketingMarketing strategiesProblemsolving skills

Branch Manager
DREAMS SOLUTIONS 5.00 to 10.00 Years Varanasi 30 Mar, 2024

Role/ Job Title: Branch Manager-Micro Business Loan Function/ Department: Micro Business Loans Job Purpose: The role entails scaling up the business for the M...
lapteam managementbusiness loanbranch managementunsecured loanspersonal loans

Data Analyst
CIEL HR 0.00 to 1.00 Years Vadodara 30 Mar, 2024

Job Title - Data Analyst Job Location - Vadodara, Gujarat CTC - Best in Industry Experience - 0-1 years (Freshers can apply) Job Role & Responsibility - Develop AI / ML solutions using data s...
data scienceadvanced analyticsdata miningSQLAWSPythonJava

International Chemical Sales Representative
Synergy Resource Solutions 4.00 to 7.00 Years Vadodara 30 Mar, 2024

Greetings from Synergy Resource Solutions, a leading HR Management Consultancy Firm. Our Client is an international food, fiberglass & chemical products Company Successfully Providing Distributi...
MarketingInternational SalesBusiness Development

Store Manager
Mohinder Singh Hiring For Farm 1.00 to 6.00 Years Udaipur 30 Mar, 2024

Responsibilities

Develop business strategies to raise our customers pool, expand store traffic and optimize profitability

Meet sales goals by training, motivating, mentori...
store managementstore operationsstores maintenanceassociate developmentstore keepingstore merchandising

Cardiologist Required
AICS Consultancy Service Pvt Ltd 0.00 to 4.00 Years Udaipur 30 Mar, 2024

We are hiring Cardiologist for a very reputed 135 Bedded Multi Super-Specialty Hospital in Rajasthan, Kerala, Haryana, Gujarat, & PAN India. Role cardiologyinterventional cardiologyinterventional cardiologist

Logistics Controller
Prime Placement Vision Pvt Ltd 0.00 to 4.00 Years Udaipur 30 Mar, 2024

A Logistics Controller, sometimes referred to as a Logistics Manager or Supply Chain Controller, is responsible for overseeing and managing all aspects of logistics and supply chain operations wi...
reverse logisticsthird-party logisticslogistics coordinationlogistics operationslogistics

ExportSales - Jodhpur
SANKALP PLACEMENTS INDIA LLP 5.00 to 10.00 Years Udaipur 30 Mar, 2024

A Reputed Export House offers an opportunity for Export Sales Manager for Jodhpur This Company is a Service Oriented Company which helps business utilize opportunities and growt...
export salesinternational salesexport marketing

Area Manager Direct | Life Insurance- Andhra Pradesh
Lavya Associates HR Services Hiring For Leading Life Insurance Companies 5.00 to 10.00 Years Tirupati 30 Mar, 2024

We have an urgent opening with most of the leading life Insurance Companies in Direct Vertical.

Manage the sales team for sales growth and revenue enhancement.
...
sales insurancecross sellinglife insurancebfsidstdirectbank

Senior Product Manager
GRAVITAS INFRASTRUCTURES PRIVATE LIMITED 9.00 to 14.00 Years Tirupati 30 Mar, 2024

We are looking for a Senior Product Manager to direct product development and ensure high return on investment (ROI.) Youll translate ideas into strategy and features, and follow product developm...
researchmarketmanagementvisionspecificationsstrategydevelopmentscrumbusinesslifecycleroadmapproject

Insurance Sales Officer
Adhaan Solution Private Limited 1.00 to 6.00 Years Surat 30 Mar, 2024

JOB ROLE:The duties of an Insurance Sales Representative include designing marketing strategies, contacting potential clients, assessing customer needs, selling appropriate insur...
communication skillssales planning

Debt Manager
ICICI Bank Ltd 3.00 to 8.00 Years Surat 30 Mar, 2024

Relationship Manager Debt Service Management Group

Category: Relationship Management ...
debt collectioncollectionsretentionrecoverycollection managementdebt recovery

Area Manager Direct | Life Insurance- Andhra Pradesh
Lavya Associates HR Services Hiring For Leading Life Insurance Companies 5.00 to 10.00 Years Rajahmundry 30 Mar, 2024

We have an urgent opening with most of the leading life Insurance Companies in Direct Vertical.

Manage the sales team for sales growth and revenue enhancement.
...
sales insurancecross sellinglife insurancebfsidstdirectbank

Branch Operations Manager
Aanya Placement Services 4.00 to 9.00 Years Rajahmundry 30 Mar, 2024

Branch Operation Manager Responsibility: Train all service managers for everyday maintenance operations for various assign branches and recommend improvements to increase effici...
operations managementproblem solvingcommunication skillsinterpersonal skills

Medical Director
GRAVITAS INFRASTRUCTURES PRIVATE LIMITED 11.00 to 21.00 Years Rajahmundry 30 Mar, 2024

We are seeking a dedicated Medical Director to ensure the efficient operation of our healthcare facility. In collaboration with administrators and nursing supervisors, you will strive to achieve ...
psychiatrymedical servicesutilization managementprimary careinternal medicineutilization reviewclinical trialsmedical managementquality improvement

Executive - Import Export
Spotlight Recruitment Services 0.00 to 1.00 Years Rajahmundry 30 Mar, 2024

We have an urgent hiring for Back Office/ Backend Executives. Candidate Profile: Age: Between 18 and35 years Educational Qualification: HSC (102) & above. Language skills: Fluency in English ...
backend operationsback office management

Commercial - Manager
Lakshman Kumar Hiring For Lakshman Enterprise 1.00 to 6.00 Years Rajkot 30 Mar, 2024

Mastermind business growth strategies to help meet organizational goals and objectives Build and nurture client relationships in order to continue winning new contracts Attend networking events a...
conducting interviewsnegotiation skillsnetwork administration

Teacher in D.A.V. School
RENOVISION TECHNOLOGY 0.00 to 1.00 Years Rajkot 30 Mar, 2024

Classroom teachers will be expected to:

have the content knowledge and pedagogical practice to meet the diverse needs of all students teacher trainingeducation policystudent disciplinecharter schoolsschool boards

Customer Care Manager
Prime Placement Vision Pvt Ltd 0.00 to 4.00 Years Rajkot 30 Mar, 2024

A Customer Care Manager is responsible for overseeing all aspects of customer service and satisfaction within a company or organization. They play a critical role in ensuring that customers recei...
customer carecustomer relationshipcustomer satisfactioncustomer service operationscustomer service systemsglobal customer service

Logistics Controller
Prime Placement Vision Pvt Ltd 0.00 to 4.00 Years Rajkot 30 Mar, 2024

A Logistics Controller, sometimes referred to as a Logistics Manager or Supply Chain Controller, is responsible for overseeing and managing all aspects of logistics and supply chain operations wi...
reverse logisticsthird-party logisticsforwardingfreight forwardingsupply chain consultinglogisticssupply chain software

Franchise Development Manager
SKILLVENTORY 1.00 to 6.00 Years Raipur 30 Mar, 2024

Role- Franchise Development Manager Industry- Battery Manufacturing Location (s) -JAMMU,LUDHIANA,JAIPUR,KOTA,RAIPUR,RAJKOT,PURNIA/MOTIHARI,RAN...
business developmentfranchisee acquisition

General Manager-Logistics/Supply Chain
FRONTLINE TECH JOB CONSULTANTS 15.00 to 25.00 Years Raipur 30 Mar, 2024

Job Description The purpose of this position is to oversee implementation of logistics operation excellence to enable timely delivery of manufactured goods to customers,...
e-procurementsupply managementsupply chain managementinventory controloperations managementinventory management

Relationship Officer
AWANTI DIGITAL CABLE AND BROAD BAND Fresher Raipur 30 Mar, 2024

JOB OPPORTUNITIES In Madhya Pradesh and Chhattisgarh Designation - Apprentice Group Credit Officer / Apprentice Individual Relationship officer...
bcomgraduatecommunication skills12th passfreshermba fresher

Business Development Associate
Epoch Olympiad Foundation Pvt Ltd 1.00 to 6.00 Years Raipur 30 Mar, 2024

We are conducting International Olympiad Exams since 2009 for classes playgroup to class 10. Till date more than 22.7 lakh students have appeared in our Olympiad Exams. Presently...
education counselingeducational salesbusiness developmentlead generationsoftware industryeducational marketing

Logistics Specialist
Prime Placement Vision Pvt Ltd 0.00 to 4.00 Years Raipur 30 Mar, 2024

As a Logistics Specialist, you will be responsible for coordinating and overseeing various aspects of the logistics and supply chain process to ensure the efficient and timely movement of goods a...
supply chain softwarereverse logisticsthird-party logisticssupply chain consulting

Hr Recruiter
Ranjay Kumar Hiring For Prime Placement Vision Pvt Ltd 0.00 to 4.00 Years Ranchi 30 Mar, 2024

The HR Recruiter is responsible for sourcing, attracting, and hiring candidates to fill open positions within the organization. They play a critical role in ensuring the company attracts and reta...
systemshr administrationhr analyticshr operationshrisresourceshuman

Franchise Development Manager
SKILLVENTORY 1.00 to 6.00 Years Ranchi 30 Mar, 2024

Role- Franchise Development Manager Industry- Battery Manufacturing Location (s) -JAMMU,LUDHIANA,JAIPUR,KOTA,RAIPUR,RAJKOT,PURNIA/MOTIHARI,RAN...
business developmentfranchisee acquisition

Doctor Relationship Associate
Unnati 2.00 to 5.00 Years Ranchi 30 Mar, 2024

As a Doctor Relationship Associate, you will be responsible for identifying and cultivating relationships with key referral sources, such as OB/GYNs, primary care physicians/ general physicians e...
business developmentlead generationsaleshealthcarerelationship building

Field sales executive Ranchi
ANANTA VYOM CONSULTANTS Hiring For BFSI Company 0.00 to 4.00 Years Ranchi 30 Mar, 2024

Title Field sales executive/Direct sales executive. JD:

Getting the sale using various customer sales methods

Forecasting sales, developing out of the box sales strategies/mo...
life insurancefield salesbfsi salesinsurance salesdirect sales

Financial Analyst Recruitment
RENUKA INTERPRISES 0.00 to 4.00 Years Ranchi 30 Mar, 2024

We have a new role open in our team for a financial analyst. You will spend your day analyzing huge amounts of financial data and preparing various accounting and financial reports based on this ...
teamworktime managementnegotiationcommunication

PREV
NEXT

educational strategies Job Openings

Senior Study Abroad Advisor

Responsibilities Develop business strategies to raise our customers pool, expand store traffic and optimize profitability Meet sales goals by training, motivating, mentori... store managementstore operationsstores maintenanceassociate developmentstore keepingstore merchandising

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Responsibilities

Develop business strategies to raise our customers pool, expand store traffic and optimize profitability

Meet sales goals by training, motivating, mentori...
store managementstore operationsstores maintenanceassociate developmentstore keepingstore merchandising