emergency nursing jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

emergency nursing Job Openings

Showing 151 - 200 of 6427 Jobs

Fire & Safety Supervisor

A-ONE STAFFING 1.00 to 10.00 Years Surat, KochiKochi, Rudrapur, Pune, Panipat, Patna 22 Jul, 2026

Urgent Requirements

safety audit

safety training

fire protection

safety case development

fire alarm system

safety engineering

safety officer activities

fire safety

safety implementation

Gastroenterologist

ANG Placement And Staffing Solutions Hiring For Gastroenterologist Consultant 1.00 to 10.00 Years Surat, Moradabad 22 Jul, 2026

endoscopic retrograde cholangiopancreatography

tube placement

polypectomy

Safety Supervisor & Safety officer

A-ONE STAFFING 1.00 to 10.00 Years Ranchi, JamshedpurJamshedpur, Bhubaneswar, Odisha 22 Jul, 2026

Urgent Requirement

Location - Bhubaneswar, Lanjigarh, Jamshedpur, Ranch...
safety managementsafety auditsafety trainingsafety officer activitiessafety inspectionsafety engineeringsafety analysissafety implementation

Chief Security Officer
JOBS HELP CONSULTANCY 1.00 to 10.00 Years Ranchi, PatnaPatna, Bhubaneswar, Indore, Lucknow, Hyderabad, Navi Mumbai, Delhi, Bhopal 22 Jul, 2026

Chief Security Officer Position Summary We are looking for a highly disciplined and dynamic Chief Security Officer (CSO) to lead the end-to-end security operations. The incumbe...
security managementarmy retiredairforceindustrial securityvigilancedefencemilitary

Plant Maintenance Head
JOBS HELP CONSULTANCY 1.00 to 10.00 Years Raipur, NagpurNagpur, Bhillai, Raigarh, Nashik, Bhubaneswar, Sonbhadra, Hyderabad, Jamshedpur, Durga 22 Jul, 2026

Plant Maintenance Head - 1. Preventive & Predictive Maintenance i. Develop and implement maintenance plans for casting machines, rolling mills, furnaces, conv...
maintenancegreenfield projectcold rolling millsteel plant

Pediatrician
ANG Placement And Staffing Solutions Hiring For Consultant Pediatrician 1.00 to 10.00 Years Raipur, KorbaKorba, Dehradun, Jaipur, Bharuch, Shajapur, Mainpuri, Jaunpur, Jhabua, Harda 22 Jul, 2026

Good morning, and Greetings from ANG Placements, Indias leading Medical Placement Consulting firm. Respecting your busy and valued schedule, we would like to share a career opportunity for the ...
opdicuemremergencycritical carechild healthventilatlatorneonatal caregrowth monitoring

Territory Sales Manager for a Medical device company
Talent Leads HR Solutions Pvt Ltd 1.00 to 10.00 Years Delhi, LucknowLucknow, Bangalore, Chennai, Hyderabad, Uttarakhand, Mumbai City, Nagpur 22 Jul, 2026

Role Purpose: The Territory Sales Manager is responsible for achieving sales targets within the assigned territory by developing strong customer relationships, managing channel partners, identify...
salesmedical equipment sales

Wanted Operation Theatre Tech,Dialysis Tech Graduates,Cardiac perfusion
ACHIEVERS SPOT Hiring For Medical Coding 1.00 to 10.00 Years Madurai, TiruchirappalliTiruchirappalli, Coimbatore, Chennai, Tiruvannamalai, Salem, Vellore, Tutico 22 Jul, 2026

DESCRIPTION
We are looking for a dedicated Microbiologist to join our team in T Nagar. This is a full-time position ideal for fresh graduates. Y...
biomedicalnursingbiotechnologymicrobiologypharmacymedical codingphysiotherapybiochemistryanaesthesiologist

Wanted Biomedical Engineer
ACHIEVERS SPOT Hiring For Medical Coding 1.00 to 10.00 Years Madurai, ThanjavurThanjavur, Coimbatore, Chennai, Salem, Nagercoil, Thiruvarur, Dharmapuri, Theni, T 22 Jul, 2026

DESCRIPTION
As a Biomedical Engineer, you will play a crucial role in developing and improving biological products and processes. Your responsibilities will include: ...
nursingbiomedical engineeringbioinformaticsvirologymedical codingpharmacybiopharmaceuticalsbiotechnologymicrobiology

for Anaesthologist & Biochemist
ACHIEVERS SPOT Hiring For MEDICAL CODING 1.00 to 10.00 Years Madurai, ThanjavurThanjavur, Coimbatore, Chennai, Salem, Pudukottai, Kanchipuram, Tuticorin, Cuddalo 22 Jul, 2026

DESCRIPTION
As an Anesthetist, you will play a crucial role in patient care, ensuring safety and comfort during surgical and medical procedures. Your primary responsi...
nursingchemistryanesthesiabiochemistrycardiac anaesthesiaparamedicalperfusion techpharmacistlife science

Medical Coding Analyst
ACHIEVERS SPOT Hiring For MEDICAL CODING 1.00 to 10.00 Years Madurai, TiruchirappalliTiruchirappalli, Erode, Chennai, Thirunelveli, Salem, Nagercoil, Tuticorin, 22 Jul, 2026

Position:Medical Coder About Achievers Spot Medical Coding is the Fastest-growing Profession in the Healthcare Industry Today. It is a Niche Specialization and...
physiotherapybiotechnologymedical codingbiomedicalpharmacynursingmedical lab technologymedical coding analystmedical coding executive

Wanted Operation Theatre Tech,Dialysis Tech Graduates,Cardiac perfusion
ACHIEVERS SPOT Hiring For Medical Coding 1.00 to 10.00 Years Madurai, TiruchirappalliTiruchirappalli, Coimbatore, Chennai, Tiruvannamalai, Salem, Vellore, Tutico 22 Jul, 2026

DESCRIPTION
We are looking for a dedicated Microbiologist to join our team in T Nagar. This is a full-time position ideal for fresh graduates. Y...
biomedicalnursingbiotechnologymicrobiologypharmacymedical codingphysiotherapybiochemistryanaesthesiologist

Wanted Biomedical Engineer
ACHIEVERS SPOT Hiring For Medical Coding 1.00 to 10.00 Years Madurai, ThanjavurThanjavur, Coimbatore, Chennai, Salem, Nagercoil, Thiruvarur, Dharmapuri, Theni, T 22 Jul, 2026

DESCRIPTION
As a Biomedical Engineer, you will play a crucial role in developing and improving biological products and processes. Your responsibilities will include: ...
nursingbiomedical engineeringbioinformaticsvirologymedical codingpharmacybiopharmaceuticalsbiotechnologymicrobiology

for Anaesthologist & Biochemist
ACHIEVERS SPOT Hiring For MEDICAL CODING 1.00 to 10.00 Years Madurai, ThanjavurThanjavur, Coimbatore, Chennai, Salem, Pudukottai, Kanchipuram, Tuticorin, Cuddalo 22 Jul, 2026

DESCRIPTION
As an Anesthetist, you will play a crucial role in patient care, ensuring safety and comfort during surgical and medical procedures. Your primary responsi...
nursingchemistryanesthesiabiochemistrycardiac anaesthesiaparamedicalperfusion techpharmacistlife science

Medical Coding Analyst
ACHIEVERS SPOT Hiring For MEDICAL CODING 1.00 to 10.00 Years Madurai, TiruchirappalliTiruchirappalli, Erode, Chennai, Thirunelveli, Salem, Nagercoil, Tuticorin, 22 Jul, 2026

Position:Medical Coder About Achievers Spot Medical Coding is the Fastest-growing Profession in the Healthcare Industry Today. It is a Niche Specialization and...
physiotherapybiotechnologymedical codingbiomedicalpharmacynursingmedical lab technologymedical coding analystmedical coding executive

Plant Safety Manager
TALENTCO HR SERVICES LLP 1.00 to 10.00 Years Navi Mumbai, Mumbai City 22 Jul, 2026

Job Title: Plant Safety Manager
Job Description
The Plant Safety...
risksafetyemergencyhseinvestigationhealthmanufacturingauditassessmentehsindustrialaccidentplantoccupationalmanager

HR Executive- Mumbai
MEGMA SERVICES 1.00 to 10.00 Years Mumbai City 22 Jul, 2026

Leading Healthcare company requires HR Executive --Kandiwali( West)-MuMBAI One of our client a leading Healthcare company with the worlds most advanced VELYS Robotic Knee Replacement System,offe...
hr executivehr generalist

Safety Officer
A-ONE STAFFING 1.00 to 10.00 Years Lucknow, AngulAngul, Kollam, Ranchi, Panipat, Coimbatore, Durgapur 22 Jul, 2026

Urgent Requirements Post - Safety Officer Experience - 1yr to 4yr Salary - 22,000 to 38,000 Facility - Living Traveling Canteen Location - Kollam, Lucknow, Ranchi,...
safety inspectionsafety trainingsafety officer activitiessafety auditsafety engineeringsafety analysis

Territory Sales Manager for a Medical device company
Talent Leads HR Solutions Pvt Ltd 1.00 to 10.00 Years Lucknow, DelhiDelhi, Bangalore, Chennai, Hyderabad, Uttarakhand, Mumbai City, Nagpur 22 Jul, 2026

Role Purpose: The Territory Sales Manager is responsible for achieving sales targets within the assigned territory by developing strong customer relationships, managing channel partners, identify...
salesmedical equipment sales

Fire & Safety Supervisor
A-ONE STAFFING 1.00 to 10.00 Years Kochi, RudrapurRudrapur, Pune, Surat, Panipat, Patna 22 Jul, 2026

Urgent Requirements Post - fire and Safety Supervisor Experience - 0 to 5yr Salary - 20,000 to 40,000 Location - Pune, Panipat, Kochi, Rudrapur, Surat, Patna Site - Industri...
safety auditsafety trainingfire protectionsafety case developmentfire alarm systemsafety engineeringsafety officer activitiesfire safetysafety implementation

Offshore vacancy Required ( Fireman )
Apex Offshore Service 1.00 to 10.00 Years Kochi, ThrissurThrissur, Kollam, Idukki, Palakkad, Guntur, Chennai, Nellore, Bellary, Kakinada 22 Jul, 2026

GREETINGS We are looking for an fresher or experienced candidate with responsible Fireman to join. Duty & Responsibility

...
safetydiplomafirefiremanfire man

Dialysis Technologist
Needs Ayurveda Private Limited 1.00 to 10.00 Years Silchar, KolarKolar, Baramulla, Dhanbad, Pondicherry, Kolkata, Pune, Rewa, Patna, Coimbatore 22 Jul, 2026

We are looking for a skilled Dialysis Technician to join our team. The ideal candidate will have a strong background in dialysis technology and excellent patient care skills. Roles and Responsib...
computer proficiencypatient caremedical servicesemergency nursingoperation theatrepatient monitoringwater treatmentdialysis therapyinfection control

CDIP Traning with Placement For Medical coding
ISKILLS SOLUTIONS 1.00 to 10.00 Years Hyderabad, ThanjavurThanjavur, Bangalore, Tiruvannamalai, Chennai, Tiruchirappalli, Vellore, Dharmap 22 Jul, 2026

We are looking for motivated and detail-oriented candidates to join our CDIP (Clinical Documentation Integrity Practitioner) Training Program with placement assistance. This p...
physiotherapypharmacydentistrybhmsnursingmbbs

Offshore vacancy Required ( Fireman )
Apex Offshore Service 1.00 to 10.00 Years Guntur, ChennaiChennai, Nellore, Kakinada, Kochi, Idukki, Bellary, Kollam, Palakkad, Thrissur 22 Jul, 2026

GREETINGS We are looking for an fresher or experienced candidate with responsible Fireman to join. Duty & Responsibility

...
safetydiplomafirefiremanfire man

Agricultural Mechanics
AYURSMITH WELLNESS (OPC) PRIVATE LIMITED 1.00 to 10.00 Years Guntur, ChennaiChennai, Hyderabad, Kurnool, Guntakal, Oman, Qatar, Bangalore, United Arab Emirates, 22 Jul, 2026

An Agricultural Engineering & Mechanics professional datanurseryemergencynaturalwaterengineeringcollectionqualitymaintenancetechnicalassistanceequipmentconservationpracticesharvestresources

Urgent Openings- Medical Coding Freshers(BAMS,BHMS,BUMS,BSMS,BDS,BNYS)
ISKILLS SOLUTIONS 1.00 to 10.00 Years Guntur, ChennaiChennai, Hyderabad, Nellore, Vijayawada, Vishakhapatnam, Bangalore, Pune, Mumbai City 22 Jul, 2026

HR Bhavani- hidden_mobile (WhatsApp) Position: Medical Coder Medical Coding is the process of conversion of text information related to healthcare services into numer...
biotechnologybiomedical engineeringcardiologyphysiotherapyoptometrymicrobiologyradiologynuclear medicine technologycardio pulmonary perfusion care technology

Site Engineer
Roche International 1.00 to 10.00 Years Guntur, ChennaiChennai, Guntakal, Anantpur, Bangalore, Noida, Pune, Mumbai City, Delhi, AndamanNicob 22 Jul, 2026

1. Understand all facets of the waste water treatment operations and equipment Must be capable of running the plant effectively in the day to day operations and respond appropriately in emergency...
commissioner activitiesinstallationstpetp operationsite supervision

Safety Supervisor
A-ONE STAFFING 1.00 to 10.00 Years Ahmedabad, MundraMundra, Mumbai City, Varanasi, Pune, Delhi 22 Jul, 2026

Urgent Requirements Post - Safety Supervisor Experience - 1yr to 5yr Salary - 20,000 to 40,000 location - Pune, Mumbai, Mundra, Ahmedabad, Delhi, Varanasi Site - Industrial,...
safety trainingsafety management systemsafety analysissafety engineeringsafety auditsafety inspection

Public Health Nurse
Needs Ayurveda Private Limited 1.00 to 10.00 Years Vadodara, PatialaPatiala, Pune, Thiruvanananthapuram, Ooty, Kohima, Tuticorin, Bikaner, Muzzafarpur, 22 Jul, 2026

Job description We are looking for a highly skilled and compassionate Nurse to join our team at Medica Superspeciality Hospital (MSH). The ideal candidate will have a strong background in n...
patient assessmentmedication adherencewound caremedication administrationpatient caremedic activitiesemergency nursinginfection controlmedical records

Agricultural Specialist
AYURSMITH WELLNESS (OPC) PRIVATE LIMITED 1.00 to 10.00 Years Gurugram, DelhiDelhi, Noida, Oman, Qatar, Saudi Arabia, Bangalore, Philippines, Chennai, Kurnool, Un 22 Jul, 2026

A park ranger safetyemergencypubliccollectionreservationsservicepatrolcustomerinterpretivefeesituationsvisitorprogramsrangersservices

Anaesthesia Technician
Needs Ayurveda Private Limited 1.00 to 10.00 Years Kanpur, ErnakulamErnakulam, Kottayam, Sivasagar, Ooty, Dalhousie, Mangalore, Muzzafarpur, Coimbatore 22 Jul, 2026

Key Responsibilities

Prepare anesthesia machines, monitors, and equipment before procedures.

Assist anesthesiologists during surgeries, emergency procedures,...
patient carepatient monitoringanaesthetist activitiesmedical monitoringoperation theatrephysician relationsnursery managementpain management

Safety Supervisor
A-ONE STAFFING 1.00 to 10.00 Years Varanasi, DelhiDelhi, Pune, Mumbai City, Mundra, Ahmedabad 22 Jul, 2026

Urgent Requirements Post - Safety Supervisor Experience - 1yr to 5yr Salary - 20,000 to 40,000 location - Pune, Mumbai, Mundra, Ahmedabad, Delhi, Varanasi Site - Industrial,...
safety trainingsafety management systemsafety analysissafety engineeringsafety auditsafety inspection

Health Officer
Needs Ayurveda Private Limited 1.00 to 10.00 Years Thiruvananthapuram, DimapurDimapur, Indore, Ongole, Chennai, Kolkata, Gulbarga, Katihar, Muzzafarpur 22 Jul, 2026

Job description We are looking for Health Assistant to join our dynamic team and embark on a rewarding career journey. Responsible for supporting doctors and nurses in patient care activi...
health care servicesnursing practicequality of carepatient communicationspatient assessmentpatient carepatient monitoringpatient relations

Staff Nurse
DOCTORS DIAGNOSTIC NUCLEAR MEDICINE AND RESEARCH CENTRE PRIVATE LIMITED 1.00 to 10.00 Years Kottayam 22 Jul, 2026

Responsibilities: * Administer medications and treatments * Collaborate with healthcare team on patient care plans * Provide quality patient care under medical supervision * Monitor vital sig...
bsc nursingnursinggnm

Public Health Nurse
Needs Ayurveda Private Limited 1.00 to 10.00 Years Thiruvanananthapuram, PatialaPatiala, Pune, Ooty, Kohima, Tuticorin, Bikaner, Vadodara, Muzzafarpur, 22 Jul, 2026

Job description We are looking for a highly skilled and compassionate Nurse to join our team at Medica Superspeciality Hospital (MSH). The ideal candidate will have a strong background in n...
patient assessmentmedication adherencewound caremedication administrationpatient caremedic activitiesemergency nursinginfection controlmedical records

Anaesthesia Technician
Needs Ayurveda Private Limited 1.00 to 10.00 Years Ernakulam, KottayamKottayam, Kanpur, Sivasagar, Ooty, Dalhousie, Mangalore, Muzzafarpur, Coimbatore, 22 Jul, 2026

Key Responsibilities

Prepare anesthesia machines, monitors, and equipment before procedures.

Assist anesthesiologists during surgeries, emergency procedures,...
patient carepatient monitoringanaesthetist activitiesmedical monitoringoperation theatrephysician relationsnursery managementpain management

Medicine Specialist
Needs Ayurveda Private Limited 1.00 to 10.00 Years Erode, SivagangaiSivagangai, Maharashtra, Pathankot, Pondicherry, Navi Mumbai, Amritsar, Alwar, Samb 22 Jul, 2026

Medicine Specialist diagnoses and treats a wide range of diseases and conditions, primarily in adults. Key responsibilities include conducting physical exams, interpreting diagnostic tests, devel...
critical care medicineemergency medicinemedical educationmedical diagnosticsdrug interactionsmedication adherencemedical terminologypatient communicationsinternal medicine

Wanted Bsc/msc Nursing/gnm/staff nurse/female nurse,dgnm,anm
ACHIEVERS SPOT Hiring For Medical Coding 1.00 to 10.00 Years Erode, MaduraiMadurai, Coimbatore, Chennai, Ramanathapuram, Pudukottai, Salem, Vellore, Nagercoil, D 22 Jul, 2026

Position: Medical Coder Ct: HR Shanmugapriya hidden_mobile We are looking for a DGNM Staff nurse Shoul...
nursingbptpharmacistbiotechnology engineerspharmaceutical technologybiomedical engineersstaff nurse

Medical Coding
ACHIEVERS SPOT Hiring For MEDICAL CODING 1.00 to 10.00 Years Erode, MaduraiMadurai, Tiruchirappalli, Chennai, Thirunelveli, Salem, Nagercoil, Tuticorin, Cuddalor 22 Jul, 2026

Position:Medical Coder About Achievers Spot Medical Coding is the Fastest-growing Profession in the Healthcare Industry Today. It is a Niche Specialization and...
medical codingpharmacyphysiotherapymicrobiologybiotechnologybiomedicalnursingbioinformaticsmedical lab technology

Site Engineer
Roche International 1.00 to 10.00 Years Delhi, NoidaNoida, Guntur, Bangalore, Chennai, Guntakal, Pune, Mumbai City, AndamanNicobar, Anantpur 22 Jul, 2026

1. Understand all facets of the waste water treatment operations and equipment Must be capable of running the plant effectively in the day to day operations and respond appropriately in emergency...
commissioner activitiesinstallationstpetp operationsite supervision

Urgent Hiring-Biotechnology,Microbiology and Nursing Freshers for Medical Coding
ISKILLS SOLUTIONS 1.00 to 10.00 Years Delhi, GunturGuntur, Bangalore, Chennai, Vijayawada, Hyderabad, Kolkata, Vishakhapatnam, Pune, Mumba 22 Jul, 2026

HR Bhavani- hidden_mobile (WhatsApp) Position: Medical Coder Medical Coding is the process of conversion of text information related to healthcare services into numer...
cardiologybiotechnologygenetic engineeringneurologyradiologybiomedical engineeringmicrobiologynursingcritical care technology

Wanted Freshers in Neuro Electrophysiology Graduates For Medical Coding
ISKILLS SOLUTIONS 1.00 to 10.00 Years Chennai, ThanjavurThanjavur, Thirunelveli, Ramanathapuram, Salem, Tiruchirappalli, Thiruvarur, Krish 22 Jul, 2026

HR Bhavani - hidden_mobile (WhatsApp) Position: Medical Coder Medical Coding is the process of conversion of text information related to healthcare services into nume...
biomedical engineeringphysiotherapynursingmicrobiologyradiologyoptometrycardiologybiotechnologyneurology

Wanted B pharm Fresher For Medical Coding
ISKILLS SOLUTIONS 1.00 to 10.00 Years Chennai, VelloreVellore, Viluppuram, Tiruchengode, Thoothukudi, Salem, Nagercoil, Dindigul, Neyveli, 22 Jul, 2026

Role- Medical Coder: We are looking to hire an fresher Coder (B Pharm, Microbiology, Biology etc.)With strong domain expertise in CPT and ICD (diagnosis) coding, the incumbent should be able to v...
radiologycardiologyanesthesianursingdialysisbiologyzoologybiochemistry

**Remote Data Center Engineering Operations Manager arenaflex $
remotepromsp 1.00 to 10.00 Years All India 20 Jul, 2026

--- Why arenaflex At arenaflex, we are a global leader in technologydriven services, spanning ereputed company, reputed company infrastructure, digital media, and AIenabled solutions. Our reputed...
Operations ManagementMechanical EngineeringElectrical EngineeringStrategic PlanningIncident ManagementPerformance MonitoringVendor ManagementTeam DevelopmentData Center Engineering

Facility Operations Manager Noida
Ileseum Clubs 1.00 to 10.00 Years Noida 20 Jul, 2026

Facility Management: Oversee the maintenance, cleanliness, and functionality of all club areas (gym floor, locker rooms, pool, spa, studios, etc.). Coordinate with vendors, technicians, and co...
Facility ManagementVendor ManagementOperations ManagementInventory ManagementProcurementStaff ManagementCustomer ServiceBudgetingFinancial OversightHealth

Senior Operation manager
Lifetime Health 1.00 to 10.00 Years Mumbai City 20 Jul, 2026

Company Description Lifetime Health is a digital-first healthcare platform focused on delivering high-quality medical services directly to peoples homes across India. The company provides a range ...
operations managementprocess improvementteam leadershipdata analysisvendor managementpartner managementquality assuranceworkflow designperformance tracking

Cctv Engineer
IMPACT INFOTECH PVT LTD 1.00 to 10.00 Years Pune 20 Jul, 2026

Job Description (JD) Security Operations Executive CCTV Monitoring (Smart City Project) Position Title: Security Operations Executive...
surveillancecctv systemcctv monitoringcctv

HR Executive (Singanallur)
Anbu Sri Sai Home Health Care 1.00 to 10.00 Years Chennai 20 Jul, 2026

Job Title: HR Executive Company: Anbu Sri Sai Home Health Care Location: 2hidden_mobile, First Floor, Trichy Rd, Singanallur, Coimbatore, Tamil Nadu 641005 Job Type:...
RecruitmentOnboardingHR AdministrationPayroll ProcessingComplianceTrainingEmployee EngagementCommunication SkillsInterpersonal Skills

Medical Coding for Biotechnology engineer,Bsc Biotech,Msc Biotech
ACHIEVERS SPOT Hiring For MEDICAL CODING 1.00 to 10.00 Years Tirupati, ChennaiChennai, Hyderabad, Thanjavur, Tamil Nadu, Vellore, Sivakasi, Theni, Namakkal, Coim 17 Jul, 2026

Ct Us: HR Shanmuga priya hidden_mobile
DESCRIPTION
Medical Coding is the fastest-grow...
nursingbiotechnologypharmacymedical codingbiomedical engineeringbotanyzoologybsc biotechbiotech engineer

Fire & Safety Supervisor Dabur India Limited
SUMIT KUMAR NEGI 1.00 to 10.00 Years Bhubaneswar, CuttackCuttack, Bangalore, Chattisgarh, Rudrapur, Haldwani, Bhillai, Bihar, Patna, Hari 17 Jul, 2026

Contact Person :97,17,22,36,28 Renu Mam
Urgent Requirements Post - fire and Safety Supervisor Expe...
safety auditfire fightingsafety officer activitiessafety trainingsafety engineeringsafety case developmentsafety implementationfire safety

PREV
NEXT

emergency nursing Job Openings

DESCRIPTION

DESCRIPTION

DESCRIPTION

DESCRIPTION

DESCRIPTION

DESCRIPTION

Job Description

We are looking for motivated and detail-oriented candidates to join our CDIP (Clinical Documentation Integrity Practitioner) Training Program with placement assistance. This p... physiotherapypharmacydentistrybhmsnursingmbbs

DESCRIPTION

Contact Person :97,17,22,36,28 Renu Mam

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

We are looking for motivated and detail-oriented candidates to join our CDIP (Clinical Documentation Integrity Practitioner) Training Program with placement assistance. This p...
physiotherapypharmacydentistrybhmsnursingmbbs