Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
Responsibilities & Key Deliverables To comply and assist plant head in organizing, controlling, maintaining a safe and healthy environment for work and study.To Investigate re...
safetytraining needsinspectionleadershiprelocationtrainingfirst aidtransformationequipment supplyrisksustainabilityequipmentrisk assessmentcontractorssafety auditsiteoffice equipmentbusinessDear Candidate, Greetings of the day! We are Hiring forProduction Head A veteran not having less than 10 years experie...
productionproduct developmentproduction planningproduction headIntroduction : Games24x7 was one of the first entrants in the gaming industry in 2006, when India started showing the first signs of promise for online gaming. We turned profitable by 2010 in ...
product managementuser experienceproduct developmentproduct designsalesdeliverynew product ideasteam managementmarketingmobile gamesonline servicesdata scienceHi Greetings of the day! We are hiring for the below mentioned position in a leading company:- Designation- Trainer (Soft Skill Trainer) Location- Pune CTC-5.50 l.p.a Day shift. Key Responsibi...
soft skills trainingtraining needs analysissoft skillstraining needsneeds analysisproject reportsbusiness writingtraining programsbehavioral trainingbehavioural trainingcompatibility testingmisdrawdesigarea sales manager in bhubaneswar Designation: Area Sales Manager Locations: Odisha (only Premier B Schools - IIMs, FMS, MDI, XLRI, SP Jai...
salesmarketingtargetretailbusiness developmentpossess strong analyticalarea salesmodern tradeteam handlinggeneral tradesales planningselling skillsproblem solvingmanagement skillstarget achievementIntroduction : Games24x7 was one of the first entrants in the gaming industry in 2006, when India started showing the first signs of promise for online gaming. We turned profitable by 2010 in j...
marketingadvertisingbrand managementsalesatldata sciencemobile gameslanding pagesbrand strategygaming industrydigital marketingexternal agenciespresentation skillsmessaging platformsarea sales manager in Bhubaneswar Designation: Area Sales Manager Locations: Odisha(only Premier B Schools - IIMs, FMS, MDI, XLRI, SP Jain, Narsee Monjee, IMT, IIFT, Symbiosis, and etc)(Please apply: ...
salesmarketingtargetretailbusiness developmentpossess strong analyticalarea salesmodern tradeteam handlinggeneral tradesales planningselling skillsproblem solvingmanagement skillstarget achievementClarivate is a global leader in providing solutions to accelerate the lifecycle of innovation. Our bold mission is to help customers solve some of the world s most complex problems b...
data visualizationmarketing analyticsmentoringdeliveryehrjavamarket accesssqlreportingus healthcarelife sciencesetlsales analyticsdrgstock exchangebrand managementdata processingmarket trendsDear Candidate, Greetings of the day! We are Hiring for, Relationship Manager Non Metro Age below 33 years- CTC upto 5.5L- Exp- 3 to 5 years Function -Retail Sales Department -Sal...
channel salesbranch salesagency salesretail salesrelationship managementJob Description B2B: SMB Enterprise Telecom Account Management and Enablement in Digital transformation journey We are looking for the following skill set to join our sales and support team: Custom...
crmsalesmarketingsales forecastingtechnical salescold callingproject managementclient servicingmanagement skillslead generationsolution saleschurn managementproblem solvingmarket shareIntroduction Games24x7 was one of the first entrants in the gaming industry in 2006, when India started showing the first signs of promise for online gaming. We turned profitable by 2010 in jus...
gamesbasicgaming industrysalesltdmobile gamesdigital marketingmobileoptionssciencefinancemistechnical compliancedata sciencemetricsaccountancyofferslife cycleoral communicationDear Candidate, Greetings of the day! We are Hiring for, Job Title -Branch Head Non Metro Age below 35- 7 to 10 years experience CTC Upto 10L Function- Retail Sales Department- Sal...
channel salesbranch salesdistributor salesretail salesrelationship managementDear Candidate, Greetings of the day! We are Hiring for, Job Title -Branch Head Non Metro Age below 35- 7 to 10 years experience CTC Upto 10L Function- Retail Sales Department- Sal...
channel salesbranch salesdistributor salesretail salessales managementrelationship managementWe create smart innovations to meet the mobility challenges of today and tomorrow. We design and manufacture a complete range of transportation systems, from high-speed trains to electric buses and dr...
power supplydata managementcompliance auditingrolling stockcontinuous improvement facilitationroot causefocal pointroot cause analysisresearch developmentThe job involves supporting the data and insights needs of Merchandizers and Marketers in Retailers, Consumer Brands and Marketplaces. Typical projects involve secondary research on internet, managin...
researchmarketingfinancial statementsproject deliverychannel partnerssecondary researchdigital transformationoperational efficiencyb2btatdesignbusinessplanning*General Description of the Job Class
*General Description of the Job Class
Key Responsibilities.
J.P. Morgan s Corporate & Investment Bank is a global leader across banking, markets and investor services. The world s most important corporations, governments and institutions entru...
product managementcustomer relationsfunctionalmarketingdocumentationbig data analyticsbig datadata analyticsshared servicescash managementworking capitalcommercial cardstatements of work sowJ.P. Morgan s Corporate & Investment Bankis a global leader across banking, markets and investor services. The world s most important corporations, governments and in...
marketingsalesproduct developmentdata analyticscash managementcommercial cardaccount servicesanalytical skillsmerchant servicestreasury servicesproject managementproduct innovationagile methodologies
We create smart innovations to meet the mobility challenges of today and tomorrow. We design and manufacture a complete range of transportation systems, from high-speed trains to electric buses and dr...
power supplydata managementcompliance auditingrolling stockcontinuous improvement facilitationroot causefocal pointroot cause analysisresearch development
Overview:
As a member of our Content production team in Hyderabad, you will supervise a team and oversee the creation of designs, postproduction animations and standards for Skillso...
content managementsopweb site productionasset managementbrochuresadobe premiere proadobe after effectssound forgevideo editingvisual designaudio editingafter effectsadobe premieregraduate leveladobe photoshopproblem solvingpost productionDividend Data Transformation Analyst
Geosys Enterprise Solutions Pvt Ltd.(Geosys) is an ISO 9001:2015 certified company which has been recognised as one of the 20 Most Promising GIS Solution Providers in 20...
new hireslife cyclehr functionslife insuranceprivate sectorleave managementmobile platformsnatural resourcestalent acquisitionemployee relationsinformation systemoral communicationemployee engagement
Key Responsibilities.
Introduction Software Developers at IBM are the backbone of our strategic initiatives to design, code, test, and provide industry-leading solutions that make the world run today - planes and trains ta...
sapdebuggingprogrammingabapacceptance testingadobe creative suitesoftware development toolscontent creationproduct adoptiondigital learningproduct knowledgedevelopment toolstechnical trainingEY Consulting - Semantic Data Model Engineer and Analyst - Senior Top 5 prerequisite skillsexperience for candidates to train up for this role, either: A software engineering backgro...
design patternsdata modelingdata collectiondata managementdata analysisdata qualitydata transportdata standardsdata model engineer data modelsdata model engineer
We have urgent opening for HR Manager for gurgaon location having 8-12 years experience salary around 50-60k.if intersted please contact us on 9911417202. JD:
Geosys Enterprise Solutions Pvt Ltd.(Geosys) is an ISO 9001:2015 certified company which has been recognised as one of the 20 Most Promising GIS Solution Providers in 20...
new hireslife cyclehr functionslife insuranceprivate sectorleave managementmobile platformsnatural resourcestalent acquisitionemployee relationsinformation systemoral communicationemployee engagement
Dear Candidate, Greetings of the day! We are Hiring forAssistant General Manager Job Description 1 Lead Generation : Marketing a...
erpsaleslead generationassistant general managerJ.P. Morgan s Corporate & Investment Bank is a global leader across banking, markets and investor services. The world s most important corporations, governments and institutions entru...
marketingsalesproduct developmentproduct managementdeliverybig data analyticsbig datadata analyticsshared servicescash managementworking capitalstatements of work sowWhat s in it for you This is a role which provides good learning opportunities to candidates who are new entrants in the field of accounting and compliances. Good exposure along with sound guidance ...
vattdscomtaxpayrolltaxationfitpadsoundvendwaitingplanninganalysismoniting
Geosys Enterprise Solutions Pvt Ltd.(Geosys) is an ISO 9001:2015 certified company which has been recognised as one of the 20 Most Promising GIS Solution Providers in 20...
new hireslife cyclehr functionslife insuranceprivate sectorleave managementmobile platformsnatural resourcestalent acquisitionemployee relationsinformation systemoral communicationemployee engagementManaging the Day to Day processing in the Loans Syndication Domain, Handling approvals, Resolving queries, Handling escalations. Very Strong process Knowledge in areas such as Letter of Credit, Static...
mentoringreportinginterpersonal skillsprocess improvementriskdeliverysqlfinancial riskcashloansjavaslamanlpgmismis reportingstatic datastrong interpersonal skillsifsstatements of work sowBusiness Area: COO & Functions Area of Expertise: Operations To gather, collate and present MI for operational and performance purposes Ensure information is accurate and reliable and gathered, collat...
accountscompatibility testingsystem developmenttime managementglobal hrcorporate actionscustomer servicebasiscontract managementsenior managementcustomer relationshr operationsreport design
© 2019 Hireejobs All Rights Reserved