Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
Key Account Manager Nature of Job The right candidate will be required to market Convergence products (Active components) along with associated application product like NMS (security product, Netwo...
accountscommunicationskillsoemnmswllmplsedgesalesavayaeyaccountmajenterprisevoicenetwkmanagementpaymentcollectionoptimizationstrategiesnecpribplJob: Sr. Sales Executive/Sales Manager , Exp._ 2 to 7 yrs. , Salary _ upto 6+ Lac p.a Angel & Genie Job: Sr. Sales Executive/Sales Manager , Exp._ 2 to 7 yrs. , Salary _ upto 6+ Lac p.a If youve regis...
keyaccountmanagementaccountmanagementoemsalesgenieretailscienceeyaccountkeyaccountsdealerdevelopmentmasterfranchisingbehavialtrainingreffoodbeerpharmasalaryagefreezersprofilesResponsible to build tie ups with large key accounts and facility management companies Responsible for new clients acquisition , commercial closure and installation for newly acquired key accounts ...
salesmarketingtargetbusinessdevelopmentinsurancekeyaccountmanagementb2bsalesaccountmanagementfacilitymanagementb2bcloudmanagementcommercialeyaccountkeyaccountsclosurevendingpaymentsinstallatiAn experienced techno- commercial experience in strategic planning, project Management, I execution & key account Management, with profit accountability. Preparation of new Proposals for meeting o...
keyaccountmanagementprojectmanagementaccountmanagementstrategicplanningbusinessrequirementsstrategymanagementoperationscommercialeyaccountpharmabusinessplanningproposalspreparationstreamliningtechnoResponsible to look after for Equipments Sales & Rental business for West & North Regions of INDIA. Sales of complete range of Piling rigs, Diaphragm wall equipments, Drilling tools etc. Client Acqui...
salesmarketingbusinessdevelopmentretailtargetclientacquisitionModernTradeeyaccountbusinessKeyAccountRelationshipsKeyAccountGrowthKeyAccountHandlingManagingKeyAccountsMarketShareNationalAccDevelop and ensure achievement of year-on-year revenue plans from designated key accounts divided into monthly, quarterly and annual plan for the region. Manage key accounts that are strategically...
keyaccountmanagementclientservicingbusinessinsightsaccountmanagementservicingmanagementoperationsdocumentationaccountseyaccountkeyaccountsateliaisonpivotalbusinessadherenceKeyAccountDeveloGood experience in Excavators/Back hoe Dealer Management Key Account Management , Desired Profile Technical qualification is Mandatory Knowledge of excavators is Mandatory...
managementdealermanagementaccountmanagementkeyaccountmanagementeyaccountExcellent Communication and interpersonal skills involving interaction with HNI Clients to provide customer service Fast learner with high energy and drive to exceed expectations coupled with good co...
hnimarketingservicingoperationsadvertisingcommunicationcustomerserviceclientservicinginterpersonalskillseyaccountHello, Greetings from Kairos Placement service llp! It was a pleasure to be in touch with you. Currently We have one Opening in one of the Dealer And Distributor Company. Please find the Below menti...
marketingmanagementsaleseyaccountdistributionmanagerbusinessdevelopmanagerdealermbachannelsales
sale the product. handle customer inquiry. solved the query responsible for tack of product. maintain data....
marketingsaleseyaccountretailsalesshowroomsalesBusiness Development-Field Executive About Company :It is a hyper-local platform to manage your daily needs. You can subscribe to your daily needs like eggs, bread, milk, curd etc and have them delive...
bdebdosalesbdmkammarketingeyaccountbusinessdevelopmentaccountmanagementrelationshipmanagerclientacquisitionnewbusinesssale the product. handle customer inquiry. solved the query responsible for tack of product. maintain data....
marketingsaleseyaccountretailsalesshowroomsalesJob Details: Roles & Responsibilities: Target new business leads & opportunities in software/mobile/web development domain Understanding Client goals/objectives and their entire digital marketing n...
ClientServicingrelationshipmanagementaccountmanagementeyaccountatesalesJob Details: Roles & Responsibilities: Target new business leads & opportunities in software/mobile/web development domain Understanding Client goals/objectives and their entire digital marketing n...
ClientServicingrelationshipmanagementaccountmanagementeyaccountatesales© 2019 Hireejobs All Rights Reserved