internal marketing jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

internal marketing Job Openings

Showing 37551 - 37600 of 46709 Jobs

Travel Sales Executive

Venus Solutions Point Hiring For Venus Solutions Point 0.00 to 4.00 Years Delhi 01 Apr, 2024

Post

Salary

Job Location -Janak Puri and Dwarka Sec-7, New Delhi

Exp

sales operational planning

Tour Package Executive

Venus Solutions Point Hiring For Venus Solutions point 2.00 to 4.00 Years Delhi 01 Apr, 2024

Area Sales Manager

KYKCorp India Pvt Ltd 3.00 to 8.00 Years Delhi 01 Apr, 2024

1-Bachelors degree and MBA preferred 2- Two to three years of experience in sales and Marketing 3-Achieving Monthly and Yearly Sales Target. 4- Good Communication Skill. ...

communication skillssalesdirect sales

International Travel sales

CAREER MISSION 1.00 to 5.00 Years Gurugram 01 Apr, 2024

travel

sales

sales and marketing manager

business interface 2.00 to 6.00 Years Delhi 01 Apr, 2024

marketing

sales

sales coordinator

business interface 2.00 to 6.00 Years Delhi 01 Apr, 2024

sales

customer

marketing

Plant Head/GM For Metal Industry

SAHYOG RECRUITMENT AGENCY 20.00 to 25.00 Years Delhi 01 Apr, 2024

Plant Head/GM For Metal Industry

Role & responsibilities

production planning

plant operations

factory administration

production management

plant management

Business Development Executive

Netambit ValueFirst Services Private Limited 3.00 to 8.00 Years Noida 01 Apr, 2024

Business Development Executive L&T

Sufin

Noida

field sales executive

sales representative

buyer onboarding

Business Development Manager for Phase-3 Ghaziabad

OM Sai Management Consulting Services 3.00 to 8.00 Years Ghaziabad 01 Apr, 2024

Required Designation:- Business Development Manager

Educational Qualification :- Should have MBA degree from reputed Institute

Salary :- 40-50 K Per Mo...
business developmentb2b marketingdirect salescold callingoutbound callingsalesmarketing

Urgent Hiring For Hr Recruiter (BDE) (Work From Home )
Desnor Destination Pvt Ltd 0.00 to 4.00 Years Delhi 01 Apr, 2024

Dear Candidate Greetings fromDesnor Destination Pvt Ltd ! Job Summary We are looking for an enthusiastic Human Resources (HR) Executive/Recruiter to implement a variety of human resource progr...
data entryonline marketingwork from homepart timefreelancingpromotionshr recruiter

Regulatory Affairs Specialist
TECHNO ENDURA 0.00 to 2.00 Years Delhi 01 Apr, 2024

Regulatory Affairs Specialist Job Description Responsibilities:

Prepare and submit regulatory documentation for new and existing medical products,including drugs,devices,and biol...
regulatory requirementsregulatory mattersregulatory guidelinesregulatory affairs

TMF Specialist
TECHNO ENDURA 0.00 to 2.00 Years Delhi 01 Apr, 2024

TMF Specialist Responsibilities:

Receive and process clinical trial documents, ensuring proper filing and indexing.

Perform quality checks on documents to en...
document managementtmfclinical researchgcphealthcare administrationclinical documentationclinical trials

Biomedical Engineer
M/S LANDCRAFT RECREATIONS PRIVATE LIMITED 5.00 to 10.00 Years Delhi 01 Apr, 2024

Bioengineers and biomedical engineers typically do the following:Design equipment and devices, such as artificial internal organs, replacements for body parts, and machines for diagnosing...
medical devicesultrasound machinesbiomedical engineeringbiomaterialshvac equipmentshealthcarepatient safetyultrasoundhospitals

Key Account Manager
Tata AIA Life Insurance Company Limited 1.00 to 6.00 Years Delhi 01 Apr, 2024

Dear Candidates, Greetings! Roles & Responsibilities, We are hiring for Key Account Manager. Role Summary:

Visit partner branches an...
salesrelationship buildingbuildingrelationshipbusiness developmentlife insurancebancassuranceinsurancelifedirectmanager

TATA AIA-Key Account Managers ||CREDIT LIFE || 2nd 3rd Apr 24 (Tue,Wed)Delhi NCR
Tata AIA Life Insurance Company Limited 0.00 to 3.00 Years Delhi 01 Apr, 2024

Hi, We have a walk-in drive for position in Key Account Managers (CREDIT LIFE - TATA CAPITAL) on 2nd and 3rd April 2024 (Tuesday,Wednesday)for ...
life insuranceinsurance salessalesbusiness development

Sales & Marketing Manager
TEKPILLAR 2.00 to 4.00 Years Mohali 01 Apr, 2024

Hiring for Agency Manager :

To recruit good quality prospective insurance advisors and ensure that they are actually acquiring licensing

M...
marketingfield salesbankingbfsifinanceagency salessalesinsuranceloan

Chartered Accountant
amit k sharma assiciates 1.00 to 3.00 Years Chandigarh 01 Apr, 2024

Chartered Accountant - Immediate joiner Roles and Responsibilities Accounting in Tally, Zoho Book, etc. GST, TDS Work, Income Tax, Excel, Word. Visiting Banks or clients office for basic liais...
AccountingTallyGSTIncome TaxExcelWordAuditingFinancial StatementsBudgetingForecastingStrategic Financial PlanningZoho BookTDS Work

Hiring For Sales Agency Development Insurance
Niyukti Management Consultants Hiring For Niyukti Management Consultants 4.00 to 9.00 Years Chandigarh 01 Apr, 2024

Required Agency Development Manager Life Insurance Co. Ltd. Location Delhi, Noida, Gurgram, Faridabad, Ghaziabad, Chandigarh, Ludhiana. Amritsar, Panchkula, ko...
insurancedirect marketingsalesagency salesinsurance salesbusinessdevelopmentchannelagency managersales officer

Urgently hiring || Packages Sales ||Travel Sales ||Holiday Executive
Venus Solutions Point Hiring For Venus Solutions Point 1.00 to 5.00 Years Chandigarh 01 Apr, 2024

Role: Sales Support & Operations - Other Industry Type: Travel & Tourism Department: Sales & Business Development Employment Type: travel agent activitiestravel planningtourism marketingtravel salestravel agency operationstourism managementtravel processtour packagestravel management

Pharma HR Recruiter
Pharma Company 10.00 to 14.00 Years Chandigarh 01 Apr, 2024

Looking for a Pharma-specific recruiter to fill technical and marketing positions for a pharma company. If you have additional skills like payroll management and coordination, it will help, but ar...
Payroll managementCoordinationPharmaspecific recruiterTechnical positions

Customer Care Representative
BHARTI HR CLEANER WALA ZEEVIKA JOBS Hiring For Optistaff Solution Private Limited 0.00 to 4.00 Years Panchkula 01 Apr, 2024

The Customer Care Representative plays a crucial role in providing exceptional customer service and support to clients or customers of the organization. They serve as the primary point of contact...
customer relationshipcustomer carecustomer service managementcustomer supportcustomer service delivery

Quality control Chemistry Analyst
Vibcare Pharma Pvt Ltd 2.00 to 6.00 Years Panchkula 01 Apr, 2024

Position Title: Chemist Analyst - Pharma Manufacturing Summary: The Chemist Analyst in Pharma Manufacturing is responsible for performing analytical testing and quality control assessments of raw...
HPLCdissolution testinganalytical method validationequipment qualificationUVVis spectroscopytitrationswet chemistry methodscGMP regulationsFDA guidelinespharmacopeial requirementsdata integrity principlesMicrosoft Office Suite

Medical Representative (Pharma)
Himscout Recruiters 1.00 to 6.00 Years Mohali 01 Apr, 2024

Responsible forSales Of Branded Generic Healthcare Formulation at the Stockist, wholesaler, and Retail Levels.

The candidate will be responsible for making sales and maintainin...
b2b salespharma salespharma marketingbusiness developmentsalesmedical

Sales Executive
Himscout Recruiters 1.00 to 6.00 Years Chandigarh 01 Apr, 2024

Responsible forSales Of Branded Generic Healthcare Formulation at the Stockist, wholesaler, and Retail Levels.

The candidate will be responsible for making sales and maintainin...
pharma salesmedical salesdirect salespharmaceutical salessales managementgeneric drugspharma marketing

MARKETING MANAGER
C Suresh Hiring For fastlinkhr 4.00 to 9.00 Years Chennai 01 Apr, 2024

We are hiring marketing manager, Requirements needed

Candidate should haveminimum 5 years experience in Education industry(preferable overseas education)

Age- below 40 y...
overseas educationeducational marketingoverseas marketing

Manager, Human Resources
Teach For India 2.00 to 5.00 Years Chennai 01 Apr, 2024

Position Summary Reporting to: City Director Directly managing: Associate HR and Admin Officer As the Manager, Human Resources you will be: Finding our people by: Working with the City Direct...
RecruitmentWorkforce PlanningSuccession PlanningOnboardingInductionPerformance ManagementEmployee RelationsData AnalysisLearningDevelopment

We are Hiring For Immigration consultant
A V Immigration and careers consultancy private limited 1.00 to 5.00 Years Chennai 01 Apr, 2024

Provide consultation services to address potential clients interest in Visas, including establishing the suitability of the candidates visa. The consultation will mainly be by email, telephone, a...
marketinginternationalbusiness developmentsales coordinationsalesdomestic sales

3D Visualizer
Shilpa Architects Planners Designers 1.00 to 5.00 Years Chennai 01 Apr, 2024

Architectural Visualizer (Junior - Mid level) About Us: Shilpa Architect is a dynamic and innovative architecture firm known for its commitment to design excellence and sustainable solutions. Wi...
3D ModelingRenderingCollaborationAutoCADSketchUp3ds MaxRevitVRayLumionAdobe PhotoshopAfter EffectsTexturingLightingPostProductionDeadline ManagementContinual Learning

Area Manager
Market Xcel Data Matrix Pvt Ltd 3.00 to 7.00 Years Chennai 01 Apr, 2024

Company Description Market Xcel Data Matrix Pvt. Ltd. is a full-service market research firm headquartered in India, with experience across diverse industries. We provide customized market resear...
Project ManagementLeadershipMarket ResearchData AnalysisCommunicationPresentationMS Office

Executive Administrative Assistant
MILLENNIUM BABYCARES PRIVATE LIMITED 8.00 to 13.00 Years Chennai 01 Apr, 2024

We are seeking a skilled Executive Administrative Assistant to deliver efficient secretarial and administrative support in a well-organized and timely manner. This role involves working closely ...
co-productionexecutive supportcoordinate meetingssales administrationaccount administrationexecutive productionexecutive correspondencemeeting schedulingsales coordinationadministrativeassistant

Banking Operations
DIRAA HR SERVICES 0.00 to 4.00 Years Chennai 01 Apr, 2024

we are hiring candidates for banking operation role(clerk,teller,assistant manager), no sales and marketing Managing client bank accounts, including opening and closing accounts, and overseeing ...
opening new accountsteller operations

Specialist, Contact Centre, Consumer Banking
DBS Bank 5.00 to 8.00 Years Chennai 01 Apr, 2024

Business Function Group Technology and Operations (T&O) enables and empowers the bank with an efficient, nimble and resilient infrastructure through a strategic focus on productivity, quality & c...
Quality ManagementTrainingCustomer ServiceBanking OperationsTeam ManagementProcess ImprovementMS Office ToolsRiskCompliance

Team Lead, Technology, Project Management, Corporate Banking; Lead...
DBS Bank 8.00 to 12.00 Years Chennai 01 Apr, 2024

Business Function Technology and Operations (T&O) enables and empowers the bank with an efficient, nimble and resilient infrastructure through a strategic focus on productivity, quality & control...
Architectural DesignMonitoringLoggingTracingAutomated TestingData ManagementJIRALeadershipCommunicationCollaborationJavaPythonJavaScriptDevOpsAutomationJenkinsSite Reliability EngineeringSRECICDObservabilityAlertingCloud Platforms

NRI-RM & Acquisition NR-RM
Acura Solutions Hiring For Reputed Bank 3.00 to 8.00 Years Chennai 01 Apr, 2024

Job Title: NRI-RM & Acquisition NR-RM for a reputed Pvt Bank Industry: Banking Qualifications: Graduate Functional Area: Sal...
nri servicesfield salesrelationship managementsalescustomer acquisition

Account Supervisor
MILLENNIUM BABYCARES PRIVATE LIMITED 14.00 to 23.00 Years Chennai 01 Apr, 2024

We are looking for an Account Supervisor to lead our account team and oversee our clients marketing campaigns and plans. In this role, you should be an excellent communicator and effective leade...
financial analysistaxationaccountingcompliancepayrollquickbooksbudgetingforecastingexcel

Assistant Director
MILLENNIUM BABYCARES PRIVATE LIMITED 5.00 to 10.00 Years Chennai 01 Apr, 2024

We are seeking a competent Assistant Director to join our team and collaborate with the director in departmental planning and progress monitoring. You will play a vital role in enhancing producti...
program developmentpowerpointcustomer serviceevent planninghuman resourceseducational programsstaff developmentfinancial reports

Executive Assistant
MILLENNIUM BABYCARES PRIVATE LIMITED 15.00 to 23.00 Years Chennai 01 Apr, 2024

We are looking for an Executive Assistant to perform a variety of administrative tasks and support our companys senior-level managers. Executive Assistants responsibilities include managing cale...
office equipmentword processingpowerpointcustomer serviceevent planningproject managementconference callsprovides administrative supportexecutive assistant

Internal Auditor
BETTER HIRE 2.00 to 4.00 Years Chennai 01 Apr, 2024

We are looking to hire an internal auditor with brilliant accounting and analytical skills. Internal auditors are expected to be organized with brilliant problem-solving skills and consta...
audit compliancetax auditinternal audittax complianceinternal audit transformation

Product Sales Executive in Chennai (Non IT )
HR Inc Consultants 1.00 to 3.00 Years Chennai 01 Apr, 2024

We are hiring for Product Sales Executive for one of our leading clients from Chennai. The person as Product Sales Executive will be responsible for all presales, sales and post sales activities. ...
Knowledge of Industry segmentstheir primary activitiesStudyPreparation for salestechnicallycommerciallyVerbalwritten communication skillsPresentation skills to position companyproduct solution to prospectsMustering internalexternal support needed

Sales Executive-Chennai
Bhoruka Extrusions 3.00 to 5.00 Years Chennai 01 Apr, 2024

1. Candidate: Skills: Problem Solving, Good Communication, Critical and creative Thinking. Personality: Dynamism, Synergetic, Responsibility, Sense of Humour, Resourcefulness. Attitude: Go-gett...
Problem SolvingGood CommunicationCritical

Regulatory Affairs Specialist
TECHNO ENDURA 0.00 to 2.00 Years Chennai 01 Apr, 2024

Regulatory Affairs Specialist Job Description Responsibilities:

Prepare and submit regulatory documentation for new and existing medical products,including drugs,devices,and biol...
regulatory requirementsregulatory mattersregulatory guidelinesregulatory affairs

TMF Specialist
TECHNO ENDURA 0.00 to 2.00 Years Chennai 01 Apr, 2024

TMF Specialist Responsibilities:

Receive and process clinical trial documents, ensuring proper filing and indexing.

Perform quality checks on documents to en...
document managementtmfclinical researchgcphealthcare administrationclinical documentationclinical trials

Biomedical Engineer
M/S LANDCRAFT RECREATIONS PRIVATE LIMITED 5.00 to 10.00 Years Chennai 01 Apr, 2024

Bioengineers and biomedical engineers typically do the following:Design equipment and devices, such as artificial internal organs, replacements for body parts, and machines for diagnosing...
medical devicesultrasound machinesbiomedical engineeringbiomaterialshvac equipmentshealthcarepatient safetyultrasoundhospitals

Urgent Opening Cluster Head Admission
A S Group 7.00 to 12.00 Years Bangalore 01 Apr, 2024

A.S. Group is currently hiring for one of the leading International School Management located in Pen India Job Details are as follows:- Designation: Cluster Head Location: Bengaluru Experienc...
admission manageradmission headcluster admission managercluster admission

Vacant Sales Managers For FMCG, Pharma, OTC, Personal care
Adidev Herbals Pvt Ltd 1.00 to 6.00 Years Bangalore 01 Apr, 2024

Required Regional / Area Sales Managers / Business development manager/Sales Executives/ Beauty Parloursales executives to market Herbal, Beauty & Personal care products/Health care products, Ayu...
personal careskin carepharmaceutical salesfmcg channel salesanti-aging productscosmetics

Data Analyst (Power BI, Python, SQL)- Internal Audit domain, Bangalore
Talent Leads HR Solutions Pvt Ltd 3.00 to 8.00 Years Bangalore 01 Apr, 2024

Qualification- Mba Finance / Mca Experience 3 years Location Bangalore BO. 5.5 Days working from Office Key responsib...
sqlpowerdata analysisdatapython

SAP Finance Subject Matter Expert (SME/Module Lead/Solution Architect)
AATRAL TECHNOLOGIES INDIA PRIVATE LIMITED 7.00 to 10.00 Years Bangalore 01 Apr, 2024

Job Title: SAP Finance Subject Matter Expert (SME/Module Lead/Solution Architect) Job Responsibilities:

Work as a SAP Finance Subject Matter Expert ...
sap fico - financial accounting / controllingsap ficofico

Marketing Manager
MILLENNIUM BABYCARES PRIVATE LIMITED 13.00 to 23.00 Years Bangalore 01 Apr, 2024

An Email Marketing Manager utilizes email communication tools to market a company and increase brand awareness. They are experts in the usage of email communications and develop marketing strateg...
marketservicemarketinganalyticscampaignspowerpointcustomerresearchmanagementdigitalprojectntegratedstrong

Graphic Designer
EduGATE Engineering Academy 1.00 to 5.00 Years Ahmedabad 01 Apr, 2024

About us: EduGATE Engineering Academy EduGATE Engineering Academy is a leading GATE coaching institute of Gujarat founded by IIT Bombay alumni in 2013. Institute has trained more than 12000 stu...
Graphic DesignVideo ProductionVideo EditingContent CreationInnovation

HR(EdTech)
Eduvacancy 2.00 to 3.00 Years Ahmedabad 01 Apr, 2024

Requirement of HR(EdTech) in Ahmedabad Qualification:-Bachelor Degree 2 to 3 years of Experience RECRUITMENT: Assisting in End to end Recruitment through various sources such as advertisement,...
RecruitmentTrainingAuditSurvey

PREV
NEXT

internal marketing Job Openings

Regulatory Affairs Specialist Job Description Responsibilities: Prepare and submit regulatory documentation for new and existing medical products,including drugs,devices,and biol... regulatory requirementsregulatory mattersregulatory guidelinesregulatory affairs

Regulatory Affairs Specialist Job Description Responsibilities: Prepare and submit regulatory documentation for new and existing medical products,including drugs,devices,and biol... regulatory requirementsregulatory mattersregulatory guidelinesregulatory affairs

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Regulatory Affairs Specialist Job Description Responsibilities:

Prepare and submit regulatory documentation for new and existing medical products,including drugs,devices,and biol...
regulatory requirementsregulatory mattersregulatory guidelinesregulatory affairs

Regulatory Affairs Specialist Job Description Responsibilities:

Prepare and submit regulatory documentation for new and existing medical products,including drugs,devices,and biol...
regulatory requirementsregulatory mattersregulatory guidelinesregulatory affairs