medical coding trainer jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

medical coding trainer Job Openings

Showing 12301 - 12350 of 19791 Jobs

Pipeline Engineer

OVERNET TRADING PRIVATE LIMITED 21.00 to 25.00 Years Faridabad,Ghaziabad, Mohali, Ambernath, Navi Mumbai, Ahmednagar, Aurangabad, Jalgaon, Nagpur, Port B 29 Oct, 2024

Child Life Specialist

NEW ERA LIFE CARE PRIVATE LIMITED 11.00 to 21.00 Years Delhi,Noida, Bangalore, Chennai, Nellore, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City 29 Oct, 2024

Data Analyst

ARYAN TECHNOLOGY 0.00 to 4.00 Years Delhi,Bangalore, Kolkata, Pune, Mumbai City 29 Oct, 2024

time series analysis

statistical modeling

enterprise data modeling

data analysis

data integration

Biomedical Technician

LEADZN PRIVATE LIMITED 10.00 to 20.00 Years Delhi,Noida, Zimbabwe, Mozambique, Bangalore, Chennai, United Arab Emirates, Hyderabad, Kolkata, Gur 29 Oct, 2024

biomedical engineering

healthcare

healthcare operations

medical equipment planning

biomedical electronics

nutritionist

analyst

Pipeline Engineer

OVERNET TRADING PRIVATE LIMITED 21.00 to 25.00 Years Mohali,Ghaziabad, Ambernath, Navi Mumbai, Faridabad, Ahmednagar, Aurangabad, Jalgaon, Nagpur, Port B 29 Oct, 2024

Wanted Bioinformatics

CORE 2 CODE Hiring For Medical Coding 0.00 to 1.00 Years Chennai,Vellore, Thirunelveli, Salem, Thoothukudi, Tiruchirappalli, Coimbatore, Karur, Erode 29 Oct, 2024

Job Requirements

Ensure all medical records are filed and processed correctly
Analyze medical records and ...
computer operatingmedical technologyanatomyenglishinterpersonal skillscommunication skills

Medical Representative (MR)

APS Hiring For APS 1.00 to 2.00 Years Chennai,Other Tamil Nadu, Bangalore, Noida, Kolkata, Mumbai City, Delhi 29 Oct, 2024

Post

Medical Representative(MR)

Division: VACCINE, PEDIA, NUTRITION (ANY ONE SEGMENTS EXPERIENCE MUST))

CTC - Upto 8 LPA

pharma salescommunication skillspharmapharma marketingbusiness developmentm.r.

Excellent Opening for Surgery Coders

CORE 2 CODE Hiring For Medical coder 0.00 to 2.00 Years Chennai,Tiruvannamalai, Viluppuram, Thoothukudi, Kanchipuram, Nagapattinam, Other Andhra Pradesh 29 Oct, 2024

Job description Hi, Excellent opportunity For Coders in Surgery coding! location: Chennai & Coimbatore Work Mode: Work from Off...
medical terminologyanatomyteam management skillscommunication skillsanalytical skills

Medical Laboratory Technician
Freelancerroshan 0.00 to 4.00 Years Chennai,Bangalore, Hyderabad, Kolkata, Canada, Pune, Mumbai City 29 Oct, 2024

We are looking for a qualified Lab Technician to undertake a variety of laboratory procedures of technical nature. You will be handling sensitive equipment to analyze samples or substances and co...
laboratory servicesvirologymicrobiologists

Hospital Administrator and admin staffs
Freelancerroshan 0.00 to 4.00 Years Chennai,Bangalore, Hyderabad, Canada, Kolkata, Pune, Mumbai City 29 Oct, 2024

We are looking for a responsible Hospital Administrator to coordinate our medical services. For this role, you should understand healthcare regulations and be able to handle medical information ...
administration managementgeneral administrationmanagement

Bulking for Ar Caller
Starworth Global Solutions 1.00 to 4.00 Years Chennai,Bangalore, Jaipur 29 Oct, 2024

Dear Connections, Greetings from Starworth global solutions. We are hiring for AR Caller / AR Follow UP / Senior AR Caller for US Health Care Process Job Title : AR Caller / Senior AR Call...
medical billingar caller

Key Account Manager
Sigma Allied Services Private Limited 2.00 to 7.00 Years Chennai 29 Oct, 2024

Greetings from Sigma! I am a Staffing Specialist at Sigma Allied Services Pvt Ltd. I am reaching out to you on an exciting job opportunity with one of our clients. Job Title : KAM (Key Account ...
retail salesfield sales

Medical Coding For Biochemistry,Bioinformatics,Microbiology -CT Karthika hr
Alpha Medical Coding Solutions 0.00 to 4.00 Years Chennai,Pondicherry, Cuddalore, Salem, Kanyakumari, Kanchipuram, Nagercoil, Vilupuram, Coimbatore, K 29 Oct, 2024

Alpha coding Solutions HR Karthiga CT -hidden_mobile (hidden_mobile Whatsapp ur resume) hidden_email Main br...
pharmabiomedicalmedical codingnursingbiotechnology industrylife science industryzoologybiochemistry

Behavioral Technician
SAIKOR SECURITY TRAINING AND SERVICES PRIVATE LIMITED 15.00 to 25.00 Years Chennai,Bangalore, Noida, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Delhi, Port Blair 29 Oct, 2024

Were looking for a dedicated and compassionate Behavioral Technician to join our medical team. Behavioral Technicians are responsible for assisting Behavior Analysts with treatment plans designed...
disabilitiesanalysishealthmanagementkidsrbtbcbaautismhomeworkdevelopmentalbehaviorsocial

Biomedical Technician
LEADZN PRIVATE LIMITED 10.00 to 20.00 Years Chennai,Zimbabwe, Mozambique, Bangalore, Noida, United Arab Emirates, Hyderabad, Kolkata, Gurugram, 29 Oct, 2024

We are looking for a dynamic biomedical technician to join our biomedical department. In this role, youll be in charge of overseeing the care and use of all biomedical equipment, performing machi...
biomedical engineeringhealthcarehealthcare operationsmedical equipment planningclinical engineeringcardiologybiomedicaltechnical processbiomedical electronicsnutritionistanalyst

AR Caller - Senior AR Caller - Denial Management (Executive)
Starworth Global Solutions 0.00 to 4.00 Years Chennai 29 Oct, 2024

Job description Position / Title :Executive - AR / Senior Executive - AR ( Denial Management ) Responsibility Areas: EXP : Minimum 1 Yrs 1. Should handle US Healthcare providers/ Physicians/ ...
ar calling medical billingus healthcarehospital billingdenial managementphysician billingar calling

Medical Office Manager
ICELAND FROZEN FOODS 15.00 to 25.00 Years Chennai,Bangalore, Hyderabad, Gurugram, Delhi 29 Oct, 2024

Medical Office Managers are responsible for the non-clinical aspects of a health care institution, such as human resources, budgeting, supplies, and customer service. A typical resume example for...
immunohematologymedical equipmentmedical microbiologyofficemedical transcriptionclinical microbiologytransfusion medicinemedical billingmedical officemedical

Medical Coding Wanted Biomedical, BSc, Nutrition Grad- Ct Priya
Alpha Medical Coding Solutions 0.00 to 2.00 Years Chennai,Tirupati, Vellore, Thoothukudi, Salem, Tiruchirappalli, Kanyakumari, Kanchipuram, Coimbatore 29 Oct, 2024

Alpha coding Solutions HR Gokulapriya hr hidden_mobile( Whatsapp ur resume) Main branch address:-No-17,JK Complex Ramanathan streetT nager Chennai -17 Medical Code...
biotechnologymedical codingphysiotherapypharmacynursingbiochemistrybiomedicalbiology

Medical Coder -Biomedical, Biotechnology, Biology Grad wanted-Ct Jayapriya
Alpha Medical Coding Solutions 0.00 to 4.00 Years Chennai,Pondicherry, Cuddalore, Salem, Kanyakumari, Nagercoil, Kanchipuram, Vilupuram, Coimbatore, K 29 Oct, 2024

Alpha coding Solutions HR Jayapriya CT -hidden_mobile (Whatsapp ur resume) hidden_email Main branch address:- No-17,JK Complex Ramanat...
bioinformaticsbhmsmicrobiologyphysiotherapybptbamsmedical codingbiotechnologybiochemistry

Medical Coding for General Lifescience,clinical nutrition Grad-Ct Karthika
Alpha Medical Coding Solutions 0.00 to 4.00 Years Chennai,Pondicherry, Cuddalore, Salem, Kanyakumari, Kanchipuram, Nagercoil, Vilupuram, Coimbatore, K 29 Oct, 2024

Alpha coding Solutions HR Karthiga CT -hidden_mobile (hidden_mobile Whatsapp ur resume) hidden_email Main br...
zoologynursingphysiotherapybiochemistrybioinformaticspharmacybiomedicalmedical codingbiotechnology

Medical Coding For B.sc, M.sc, Biology, Botany, Zoology Grad -Ct JayaPriya
Alpha Medical Coding Solutions 0.00 to 4.00 Years Chennai,Pondicherry, Cuddalore, Salem, Kanyakumari, Nagercoil, Kanchipuram, Vilupuram, Coimbatore, K 29 Oct, 2024

Alpha coding Solutions HR Jayapriya CT -hidden_mobile (Whatsapp ur resume) hidden_email Main branch address:- No-17,JK Complex Ramanat...
medical codingbiochemistrybamsbptmicrobiologybiotechnologybioinformaticsbhmsphysiotherapy

Medical Coding Freshers for Clinical care Technology-Ct Karthika
Alpha Medical Coding Solutions 0.00 to 4.00 Years Chennai,Pondicherry, Cuddalore, Salem, Kanyakumari, Nagercoil, Kanchipuram, Vilupuram, Coimbatore, K 29 Oct, 2024

Alpha coding Solutions HR Karthiga CT -hidden_mobile (hidden_mobile Whatsapp ur resume) hidden_email Main br...
biochemistryzoologymedical codingbioinformaticsnursingbiomedicalpharmacyphysiotherapybiotechnology

Medical Coding Pharmacy, Physiotherapy, Bds, Nursing Grad-Ct Karthika
Alpha Medical Coding Solutions 0.00 to 4.00 Years Chennai,Pondicherry, Cuddalore, Salem, Kanyakumari, Nagercoil, Kanchipuram, Vilupuram, Coimbatore, K 29 Oct, 2024

Alpha coding Solutions HR Karthiga CT -hidden_mobile (hidden_mobile Whatsapp ur resume) hidden_email Main br...
biomedicalbiochemistrymedical codingbioinformaticspharmacybiotechnologynursingzoologyphysiotherapy

Medical Coding for Nutrition and Dietitian Wanted -CT Priya
Alpha Medical Coding Solutions 0.00 to 2.00 Years Chennai,Vellore, Thanjavur, Madurai, Salem, Thoothukudi, Tiruchirappalli, Coimbatore, Bangalore, Hyd 29 Oct, 2024

Medical Coding Job HR Gokulapriya hr hidden_mobile( Whatsapp ur resume) Position: Medical Coder Medical Coding...
physiotherapymedical codingnursingbiochemistrybptmptzoologypharmacybiomedical

Medical Coder - Bsc, Physician Assistant , Medical coding - Ct Priya HR
Alpha Medical Coding Solutions 0.00 to 2.00 Years Chennai,Tirupati, Vellore, Thoothukudi, Salem, Kanyakumari, Tiruchirappalli, Kanchipuram, Coimbatore 29 Oct, 2024

Alpha coding Solutions HR Gokulapriya hr hidden_mobile( Whatsapp ur resume) Main branch address:-No-17,JK Complex Ramanathan streetT nager Chennai -17 Medical Code...
biologynursingmedical codingpharmacybiochemistrybiomedicalphysiotherapybiotechnology

Medical coder ANM GNM Bsc Nursing Staff Nurse -Ct JayaPriya
Alpha Medical Coding Solutions 0.00 to 4.00 Years Chennai,Pondicherry, Cuddalore, Salem, Kanyakumari, Nagercoil, Kanchipuram, Vilupuram, Coimbatore, K 29 Oct, 2024

Alpha coding Solutions HR Jayapriya CT -hidden_mobile (Whatsapp ur resume) hidden_email Main branch address:- No-17,JK Complex Ramanat...
bhmsbiochemistrybamsmicrobiologybioinformaticsbiotechnologybptphysiotherapymedical coding

medical coder for B.E B.Tech Biomedical biotechnology Bioinformatics- CT Jp
Alpha Medical Coding Solutions 0.00 to 2.00 Years Chennai,Vellore, Thanjavur, Madurai, Salem, Thoothukudi, Tiruchirappalli, Coimbatore, Bangalore, Hyd 29 Oct, 2024

Medical Coding Job CT HR JayaPriya-hidden_mobile(Whatsapp ) Position: Medical Coder medical codingbiochemistrypharmacybiomedicalmptbiotechnologyzoologynursingphysiotherapy

Medical Coders - Freshers-Ct JayaPriya
Alpha Medical Coding Solutions 0.00 to 4.00 Years Chennai,Pondicherry, Cuddalore, Salem, Kanyakumari, Kanchipuram, Nagercoil, Vilupuram, Coimbatore, K 29 Oct, 2024

Alpha coding Solutions HR Jayapriya CT -hidden_mobile (Whatsapp ur resume) hidden_email Main branch address:- No-17,JK Complex Ramanat...
biotechnologyphysiotherapymedical codingbptbhmsbamsbioinformaticsbiochemistrymicrobiology

Sap Abap Developer
ARYAN TECHNOLOGY 0.00 to 4.00 Years Chennai,Bangalore, Noida, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Delhi 29 Oct, 2024

Responsibilities:

Develop and maintain SAP design and technical specification documents, and conduct unit, integration and release testing to validate fun...
client administrationenhancement pointsabap-oosap basissap abapbasis administrationsap

Medical Coding Critical Care,Clinical Care Technology- Ct Priya
Alpha Medical Coding Solutions 0.00 to 2.00 Years Chennai,Tirupati, Vellore, Thoothukudi, Salem, Kanyakumari, Tiruchirappalli, Kanchipuram, Coimbatore 29 Oct, 2024

Alpha coding Solutions HR Gokulapriya hr hidden_mobile( Whatsapp ur resume) Main branch address:-No-17,JK Complex Ramanathan streetT nager Chennai -17 Medical Code...
biomedicalbiologybiochemistrynursingpharmacyphysiotherapymedical codingbiotechnology

Medical Coding For Nursing, BPT, Pharmacy Grad -Ct JayaPriya
Alpha Medical Coding Solutions 0.00 to 4.00 Years Chennai,Pondicherry, Cuddalore, Salem, Kanyakumari, Nagercoil, Kanchipuram, Vilupuram, Coimbatore, K 29 Oct, 2024

Alpha coding Solutions HR Jayapriya CT -hidden_mobile (Whatsapp ur resume) hidden_email Main branch address:- No-17,JK Complex Ramanat...
microbiologybhmsbiotechnologybiochemistryphysiotherapybptbamsmedical codingbioinformatics

Medical coding -karthiga HR
Alpha Medical Coding Solutions 0.00 to 4.00 Years Chennai,Pondicherry, Cuddalore, Salem, Kanyakumari, Nagercoil, Kanchipuram, Vilupuram, Coimbatore, K 29 Oct, 2024

Alpha coding Solutions HR Karthiga CT -hidden_mobile (hidden_mobile Whatsapp ur resume) hidden_email Main br...
medical codinglife science industrybiomedicalbiotechnology industry

AR Caller US Medical Billing mmediate joining Blore Pune Chennai
WHITE HORSE MANPOWER CONSULTANCY (P) LTD 2.00 to 7.00 Years Bangalore,Chennai, Hyderabad 29 Oct, 2024

AR Caller US Medical Billing mmediate joining Blore Pune Chennai Medical billing software, clearinghouses, and insurance portals. Exp Microsoft Office (Excel, Word) and strong data entry skills....
medical billingar callingar caller

Medical Coder - Biomedical, Biotech, Bio-Chem Grad- CT Priya
Alpha Medical Coding Solutions 0.00 to 2.00 Years Bangalore,Salem, Vellore, Thanjavur, Madurai, Chennai, Thoothukudi, Hyderabad, Tiruchirappalli, Coim 29 Oct, 2024

Medical Coding Job CT HR Gokulapriya-hidden_mobile(Whatsapp ) Position: Medical Coder zoologymedical codingbptpharmacynursingbiochemistryphysiotherapymptbiotechnology

Bulking for Ar Caller
Starworth Global Solutions 1.00 to 4.00 Years Bangalore,Jaipur, Chennai 29 Oct, 2024

Dear Connections, Greetings from Starworth global solutions. We are hiring for AR Caller / AR Follow UP / Senior AR Caller for US Health Care Process Job Title : AR Caller / Senior AR Call...
medical billingar caller

Business Development Executive
MEDI TRANSCARE PRIVATE LIMITED 1.00 to 6.00 Years Bangalore 29 Oct, 2024

HI, We have a vacancy for leading MNC medical devices company on Medi Transcare employent. Designation: BDE Location: Bangalore/ Bengaluru JOB Description

Mee...
sellingsalescommunicationpharmadevices

Front Desk Officer
AANVII HEARING SOLUTIONS PRIVATE LIMITED 2.00 to 7.00 Years Bangalore 29 Oct, 2024

Job Summary: The Clinical Representative will be responsible for welcoming patients and visitors, managing appointment schedules, maintaining patient files, ensuring effective communication, and ...
front deskreceptionist activitiesfront office

URGENT HIRING IPDRG CODER,RADIOLOGY CODER,HOMEHEALTH,DENIAL CODER,HCC CODER
Starworth Global Solutions 1.00 to 6.00 Years Bangalore,Chennai 29 Oct, 2024

DOMAIN: IPDRG CODER, RADIOLOGY CODER,DENIAL CODER,HOME HEALTH CODER,HCC CODER EXP: MINIMUM 1 YEAR EXPERIENCE IN ANY CODING(IPDRG,RADIOLOGY,DENIAL,HOMEHEALTH,HCC) LOCATION: CHENNAI ,BANGALORE <...
hccradiologyipdrgdenial

HCC Coder - Bangalore
Starworth Global Solutions 1.00 to 3.00 Years Bangalore 29 Oct, 2024

HCC CODERS EXPERIENCE : 1Yrs LOCATION: Bangalore SALARY : 55K Skills Set - ICD 10 codes & Procedures, CPT Codes, knowledge of Anatomy, Physiology & medical terminology Experience - Min 1 yea...
hcc codinghccmedical codinghealthcare

Child Life Specialist
NEW ERA LIFE CARE PRIVATE LIMITED 11.00 to 21.00 Years Bangalore,Chennai, Noida, Nellore, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City, Delhi 29 Oct, 2024

We are looking for a Child Life Specialist to join our team and help our pediatric patients have a more relaxing and effective recovery time while in our healthcare facility. Child Life Speciali...
collaborationleadershipcommunicationadvocacytherapydevelopmentpatienceemotionalservicesfamilylifeempathychildplayengaging

Behavioral Technician
SAIKOR SECURITY TRAINING AND SERVICES PRIVATE LIMITED 15.00 to 25.00 Years Bangalore,Noida, Chennai, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Delhi, Port Blair 29 Oct, 2024

Were looking for a dedicated and compassionate Behavioral Technician to join our medical team. Behavioral Technicians are responsible for assisting Behavior Analysts with treatment plans designed...
disabilitiesanalysishealthmanagementkidsrbtbcbaautismhomeworkdevelopmentalbehaviorsocial

Biomedical Technician
LEADZN PRIVATE LIMITED 10.00 to 20.00 Years Bangalore,Zimbabwe, Mozambique, Noida, Chennai, United Arab Emirates, Hyderabad, Kolkata, Gurugram, 29 Oct, 2024

We are looking for a dynamic biomedical technician to join our biomedical department. In this role, youll be in charge of overseeing the care and use of all biomedical equipment, performing machi...
biomedical engineeringhealthcarehealthcare operationsmedical equipment planningclinical engineeringcardiologybiomedicaltechnical processbiomedical electronicsnutritionistanalyst

Cyber Security Trainer/ IT Trainer
TechDefence 3.00 to 7.00 Years Ahmedabad,Other Gujarat 29 Oct, 2024

Company Description TechDefence is an innovative and visionary IT security company based in Ahmedabad. We specialize in technical threat management, cyber security consulting, SOC service, and do...
Application SecurityNetwork SecurityMalware Analysis

Drug Safety Associate
JAI AMBEY EMERGENCY SERVICES (I) PRIVATE LIMITED 2.00 to 7.00 Years Ahmedabad,Chennai, Kochi, Vishakhapatnam, Kolkata, Silchar, Tawang, Panna, Other Bihar, Other Karnat 29 Oct, 2024

Drug safety associate provides advice to case processing team in data entry of clinical trial SAEs into Argus safety database and to medical coding of adverse events and diseases according to Med...
pharmaceutical medicinemedical affairsclinical trialsdrug safetydrug accountabilitydrug regulatory affairsdrug monitoring

Billing Analyst
Divya Staffing Solution 0.00 to 4.00 Years Pune,Dehradun, Kolkata, Belgaum, Manali, Vasco Da Gama, Dibrugarh, Ahmedabad, Shimla, Guwahati 24 Oct, 2024

The billing analysts responsibilities include coordinating with other departments to ensure all sales and orders are accurately billed for, setting clients up for billing, issuing invoice Billin...
billinghealthcarepatient assessmentpatient care

Hospital Administrator and admin staffs
Freelancerroshan 0.00 to 4.00 Years Pune,Bangalore, Chennai, Hyderabad, Canada, Kolkata, Mumbai City 24 Oct, 2024

We are looking for a responsible Hospital Administrator to coordinate our medical services. For this role, you should understand healthcare regulations and be able to handle medical information ...
administration managementgeneral administrationmanagement

Territory Manager EDS - Nagpur, India
Dentsply Sirona 3.00 to 7.00 Years Nagpur,Other Maharashtra 24 Oct, 2024

Dentsply Sirona is the worlds largest manufacturer of professional dental products and technologies, with a 130-year history of innovation and service to the dental industry and patients worldwide...
Customer Relationship ManagementSalesProduct KnowledgeMarket AnalysisCustomer Service

We are Hiring RMO
TEAMLINK CONSULTANTS (OPC) PRIVATE LIMITED 1.00 to 3.00 Years Nagpur 24 Oct, 2024

Job Description RMO Job In Nagpur Location Qualification : BHMS/BAMS Designation : RMO(Resident Medical Officer) Experience : 1 To 3 Years Location : Nagpur...
patient assessmentpatient carepatient monitoring

QA Selenium Automation IRC227463
GlobalLogic 5.00 to 9.00 Years Nagpur,Other Maharashtra 24 Oct, 2024

Description: A leading US telecom provider is seeking a Manual QA to join its API Program & Developers Portal Creation. Requirements: Must have 5 Years of Experience. Test planning and Test De...
Manual QATest planningTest DesignDefect trackingSTLCSDLCPerformance testingSecurity testingAutomation testingMobile testingTest environment preparationExecution of Test casesQA ProcessesCloudWeb platformWritten communication skillsOral comm

Medical Office Manager
ICELAND FROZEN FOODS 15.00 to 25.00 Years Delhi,Bangalore, Chennai, Hyderabad, Gurugram 24 Oct, 2024

Medical Office Managers are responsible for the non-clinical aspects of a health care institution, such as human resources, budgeting, supplies, and customer service. A typical resume example for...
immunohematologymedical equipmentmedical microbiologyofficemedical transcriptionclinical microbiologytransfusion medicinemedical billingmedical officemedical

PREV
NEXT

medical coding trainer Job Openings

Job description Hi, Excellent opportunity For Coders in Surgery coding! location: Chennai & Coimbatore Work Mode: Work from Off... medical terminologyanatomyteam management skillscommunication skillsanalytical skills

Responsibilities:

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Job description Hi, Excellent opportunity For Coders in Surgery coding! location: Chennai & Coimbatore Work Mode: Work from Off...
medical terminologyanatomyteam management skillscommunication skillsanalytical skills