nursing actions jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

nursing actions Job Openings

Showing 251 - 300 of 10223 Jobs

Plant Finance head, Ahemdabad (Mehemdabad)

Job Search Hiring For Pharmaceutical Manufacturing Plant 1.00 to 10.00 Years Ahmedabad 28 Jul, 2026

Job Title:

Location:

Reporting To:

Experience: treasurybudgetingmisgovernanceforecastingbusiness partneringcontrolsmanufacturing finance

Urgent Openings- Medical Coding Freshers(BAMS,BHMS,BUMS,BSMS,BDS,BNYS)
ISKILLS SOLUTIONS 1.00 to 10.00 Years Vijayawada, GunturGuntur, Nellore, Vishakhapatnam, Bangalore, Chennai, Hyderabad, Pune, Mumbai City, 22 Jul, 2026

HR Bhavani- hidden_mobile (WhatsApp) Position: Medical Coder Medical Coding is the process of conversion of text information related to healthcare services into numer...
biotechnologybiomedical engineeringcardiologyphysiotherapyoptometrymicrobiologyradiologynuclear medicine technologycardio pulmonary perfusion care technology

Public Health Nurse
Needs Ayurveda Private Limited 1.00 to 10.00 Years Vadodara, PatialaPatiala, Pune, Thiruvanananthapuram, Ooty, Kohima, Tuticorin, Bikaner, Muzzafarpur, 22 Jul, 2026

Job description We are looking for a highly skilled and compassionate Nurse to join our team at Medica Superspeciality Hospital (MSH). The ideal candidate will have a strong background in n...
patient assessmentmedication adherencewound caremedication administrationpatient caremedic activitiesemergency nursinginfection controlmedical records

Medical Coding for Biotechnology engineer,Bsc Biotech,Msc Biotech
ACHIEVERS SPOT Hiring For MEDICAL CODING 1.00 to 10.00 Years Tirupati, ChennaiChennai, Hyderabad, Thanjavur, Tamil Nadu, Vellore, Sivakasi, Theni, Namakkal, Coim 22 Jul, 2026

Ct Us: HR Shanmuga priya hidden_mobile
DESCRIPTION
Medical Coding is the fastest-grow...
nursingbiotechnologypharmacymedical codingbiomedical engineeringbotanyzoologybsc biotechbiotech engineer

Asst Manager Collection Auto Loan Surat, rajkot, Motihari,
Talent Leads HR Solutions Pvt Ltd 1.00 to 10.00 Years Surat, RajkotRajkot, Anand 22 Jul, 2026

Allocation of portfolio to vendor basis the past performance trend and FOS availability, creating adequate manpower capacity for the portfolio.

Review cases with FOS / TL and w...
collection managementcollections

Store Manager(Jewellery) Nasik, Ahmedabad, Surat, Mumbai
Talent Leads HR Solutions Pvt Ltd 1.00 to 10.00 Years Surat, NashikNashik, Ahmedabad, Mumbai City 22 Jul, 2026

Develop and implement sales strategies for sales mix, ticket size, conversion ratio, monthly scheme conversions, repeat buying ratio to achieve and exceed sales targets. Monitor and analyse sale...
jewellerysalesstore management

Safety Supervisor & Safety officer
A-ONE STAFFING 1.00 to 10.00 Years Ranchi, JamshedpurJamshedpur, Bhubaneswar, Odisha 22 Jul, 2026

Urgent Requirement Post - Safety Supervisor & Safety officer Exp- Fresher Experience Both Salary - 20000 to 30000 Location - Bhubaneswar, Lanjigarh, Jamshedpur, Ranch...
safety managementsafety auditsafety trainingsafety officer activitiessafety inspectionsafety engineeringsafety analysissafety implementation

Plant Maintenance Head
JOBS HELP CONSULTANCY 1.00 to 10.00 Years Raipur, NagpurNagpur, Bhillai, Raigarh, Nashik, Bhubaneswar, Sonbhadra, Hyderabad, Jamshedpur, Durga 22 Jul, 2026

Plant Maintenance Head - 1. Preventive & Predictive Maintenance i. Develop and implement maintenance plans for casting machines, rolling mills, furnaces, conv...
maintenancegreenfield projectcold rolling millsteel plant

Key Account Manager
MTG LEARNING MEDIA PVT LTD 1.00 to 10.00 Years Gurugram 22 Jul, 2026

Key Account Manager Job Description (SOF)

Serve as the primary point of contact for a portfolio of 100150 key accounts, building strong, long-...
client acquisitionsalesclient retentionkey account management

Quality Inspector
NEWAGE TECH SOLUTION PRIVATE LIMITED 1.00 to 10.00 Years Noida, DelhiDelhi, Bangalore, Chennai, Hyderabad, Gurugram, Pune, Mumbai City 22 Jul, 2026

Key Responsibilities: - Inspect and evaluate incoming raw materials, in-process components, and finished products against defined quality specifications, drawings, and acceptance criteria - Cond...
fmeappapiso 9001cmmspcnon-conformancemeasuring instruments

Territory Sales Manager for a Medical device company
Talent Leads HR Solutions Pvt Ltd 1.00 to 10.00 Years Delhi, LucknowLucknow, Bangalore, Chennai, Hyderabad, Uttarakhand, Mumbai City, Nagpur 22 Jul, 2026

Role Purpose: The Territory Sales Manager is responsible for achieving sales targets within the assigned territory by developing strong customer relationships, managing channel partners, identify...
salesmedical equipment sales

Quality Control Coordinator
FW FUTURESWINGS PRODUCTS & SERVICES (OPC) PRIVATE LIMITED 1.00 to 10.00 Years Mangalore, MysoreMysore, Chennai, Bangalore, Belgaum, Jaipur, Kochi, Chittoor, Pondicherry, Kollam 22 Jul, 2026

A Quality Control Coordinator is a professional responsible for ensuring that a companys products or services meet established quality standards. This may include reviewing and inspecting product...
controlmanagementprocesssystemsqualityproblem-solvingprojectattentiondetail

Wanted Operation Theatre Tech,Dialysis Tech Graduates,Cardiac perfusion
ACHIEVERS SPOT Hiring For Medical Coding 1.00 to 10.00 Years Madurai, TiruchirappalliTiruchirappalli, Coimbatore, Chennai, Tiruvannamalai, Salem, Vellore, Tutico 22 Jul, 2026

DESCRIPTION
We are looking for a dedicated Microbiologist to join our team in T Nagar. This is a full-time position ideal for fresh graduates. Y...
biomedicalnursingbiotechnologymicrobiologypharmacymedical codingphysiotherapybiochemistryanaesthesiologist

Wanted Biomedical Engineer
ACHIEVERS SPOT Hiring For Medical Coding 1.00 to 10.00 Years Madurai, ThanjavurThanjavur, Coimbatore, Chennai, Salem, Nagercoil, Thiruvarur, Dharmapuri, Theni, T 22 Jul, 2026

DESCRIPTION
As a Biomedical Engineer, you will play a crucial role in developing and improving biological products and processes. Your responsibilities will include: ...
nursingbiomedical engineeringbioinformaticsvirologymedical codingpharmacybiopharmaceuticalsbiotechnologymicrobiology

for Anaesthologist & Biochemist
ACHIEVERS SPOT Hiring For MEDICAL CODING 1.00 to 10.00 Years Madurai, ThanjavurThanjavur, Coimbatore, Chennai, Salem, Pudukottai, Kanchipuram, Tuticorin, Cuddalo 22 Jul, 2026

DESCRIPTION
As an Anesthetist, you will play a crucial role in patient care, ensuring safety and comfort during surgical and medical procedures. Your primary responsi...
nursingchemistryanesthesiabiochemistrycardiac anaesthesiaparamedicalperfusion techpharmacistlife science

Medical Coding Analyst
ACHIEVERS SPOT Hiring For MEDICAL CODING 1.00 to 10.00 Years Madurai, TiruchirappalliTiruchirappalli, Erode, Chennai, Thirunelveli, Salem, Nagercoil, Tuticorin, 22 Jul, 2026

Position:Medical Coder About Achievers Spot Medical Coding is the Fastest-growing Profession in the Healthcare Industry Today. It is a Niche Specialization and...
physiotherapybiotechnologymedical codingbiomedicalpharmacynursingmedical lab technologymedical coding analystmedical coding executive

Wanted Operation Theatre Tech,Dialysis Tech Graduates,Cardiac perfusion
ACHIEVERS SPOT Hiring For Medical Coding 1.00 to 10.00 Years Madurai, TiruchirappalliTiruchirappalli, Coimbatore, Chennai, Tiruvannamalai, Salem, Vellore, Tutico 22 Jul, 2026

DESCRIPTION
We are looking for a dedicated Microbiologist to join our team in T Nagar. This is a full-time position ideal for fresh graduates. Y...
biomedicalnursingbiotechnologymicrobiologypharmacymedical codingphysiotherapybiochemistryanaesthesiologist

Wanted Biomedical Engineer
ACHIEVERS SPOT Hiring For Medical Coding 1.00 to 10.00 Years Madurai, ThanjavurThanjavur, Coimbatore, Chennai, Salem, Nagercoil, Thiruvarur, Dharmapuri, Theni, T 22 Jul, 2026

DESCRIPTION
As a Biomedical Engineer, you will play a crucial role in developing and improving biological products and processes. Your responsibilities will include: ...
nursingbiomedical engineeringbioinformaticsvirologymedical codingpharmacybiopharmaceuticalsbiotechnologymicrobiology

for Anaesthologist & Biochemist
ACHIEVERS SPOT Hiring For MEDICAL CODING 1.00 to 10.00 Years Madurai, ThanjavurThanjavur, Coimbatore, Chennai, Salem, Pudukottai, Kanchipuram, Tuticorin, Cuddalo 22 Jul, 2026

DESCRIPTION
As an Anesthetist, you will play a crucial role in patient care, ensuring safety and comfort during surgical and medical procedures. Your primary responsi...
nursingchemistryanesthesiabiochemistrycardiac anaesthesiaparamedicalperfusion techpharmacistlife science

Medical Coding Analyst
ACHIEVERS SPOT Hiring For MEDICAL CODING 1.00 to 10.00 Years Madurai, TiruchirappalliTiruchirappalli, Erode, Chennai, Thirunelveli, Salem, Nagercoil, Tuticorin, 22 Jul, 2026

Position:Medical Coder About Achievers Spot Medical Coding is the Fastest-growing Profession in the Healthcare Industry Today. It is a Niche Specialization and...
physiotherapybiotechnologymedical codingbiomedicalpharmacynursingmedical lab technologymedical coding analystmedical coding executive

Plant Safety Manager
TALENTCO HR SERVICES LLP 1.00 to 10.00 Years Navi Mumbai, Mumbai City 22 Jul, 2026

Job Title: Plant Safety Manager
Job Description
The Plant Safety...
risksafetyemergencyhseinvestigationhealthmanufacturingauditassessmentehsindustrialaccidentplantoccupationalmanager

Finacle Support
Wroots Global Private Limited 1.00 to 10.00 Years Mumbai City 22 Jul, 2026

Issues & outages troubleshooting and quick resolution.

Level-1 SR closures.

Daily Checklist executions ( EOD and BOD Jobs)

Daily...
supportoraclefinaclecore

Head of Durability
SOFT AND HARD SKILL DEVELOPMENT PRIVATE LIMITED 1.00 to 10.00 Years Ludhiana, DelhiDelhi, Bangalore, Chennai, Noida, Rajkot, Vadodara, Coimbatore 22 Jul, 2026

Are You Ready to Own Product Longevity and Define Industry Standards We are seeking a visionary, results-driven Head of Durability to lead our durability strategy and ensure our...
manufacturing engineeringmechanical engineeringdurability testinglarge assembly managementstructural engineeringelectromechanicaldurability

Safety Officer
A-ONE STAFFING 1.00 to 10.00 Years Lucknow, AngulAngul, Kollam, Ranchi, Panipat, Coimbatore, Durgapur 22 Jul, 2026

Urgent Requirements Post - Safety Officer Experience - 1yr to 4yr Salary - 22,000 to 38,000 Facility - Living Traveling Canteen Location - Kollam, Lucknow, Ranchi,...
safety inspectionsafety trainingsafety officer activitiessafety auditsafety engineeringsafety analysis

Territory Sales Manager for a Medical device company
Talent Leads HR Solutions Pvt Ltd 1.00 to 10.00 Years Lucknow, DelhiDelhi, Bangalore, Chennai, Hyderabad, Uttarakhand, Mumbai City, Nagpur 22 Jul, 2026

Role Purpose: The Territory Sales Manager is responsible for achieving sales targets within the assigned territory by developing strong customer relationships, managing channel partners, identify...
salesmedical equipment sales

IT Infrastructure Engineer
ChavaraMatrimonycom 1.00 to 10.00 Years Kochi 22 Jul, 2026

IT Infrastructure Engineer Key Skills & Responsibilities Manage and maintain enterprise IT infrastructure, ensuring high availability, performance, and security Administer Zscaler ZIA and ZPA t...
IT infrastructure managementfirewall managementVPN configurationVLAN configurationMicrosoft AzureVirtual MachinesZscaler ZIAZscaler ZPAnetwork switching

Dialysis Technologist
Needs Ayurveda Private Limited 1.00 to 10.00 Years Silchar, KolarKolar, Baramulla, Dhanbad, Pondicherry, Kolkata, Pune, Rewa, Patna, Coimbatore 22 Jul, 2026

We are looking for a skilled Dialysis Technician to join our team. The ideal candidate will have a strong background in dialysis technology and excellent patient care skills. Roles and Responsib...
computer proficiencypatient caremedical servicesemergency nursingoperation theatrepatient monitoringwater treatmentdialysis therapyinfection control

Plant Head - Automobile Manufacturing
JOBS HELP CONSULTANCY 1.00 to 10.00 Years Indore, BangaloreBangalore, Cuttack, Noida, Chennai, Gurugram, Navi Mumbai, Pune, Bawal, Hoshiarpur 22 Jul, 2026

Plant Head - Automobile Manufacturing Key Responsibilities: Leadership & Management: The role involves driving operational excellence, improving productivity,...
plant managementplant layoutplant machineryppcplant operationsproduction planningsupply chain managementmulti-plant operationsfactory management

Business Development Manager
Acura Solutions 1.00 to 10.00 Years Indore, DehradunDehradun, Chandigarh, Coimbatore 22 Jul, 2026

Key Responsibilities:

Drive branch-level initiatives to achieve overall sales objectives.

Monitor and ensure achievement of monthly and weekly sales targe...
communication skillssales

Quality Executive Dabur India Limited
SUMIT KUMAR NEGI 1.00 to 10.00 Years Indore, UjjainUjjain, Jabalpur, Gwalior, Bhopal, Katni, Ratlam, Sagar, Satna, Madhya Pradesh 22 Jul, 2026

Contact Person : 97,17,22,36,28Renu Mam DABUR INDIA LIMITED
Job description We are looking for a highly skilled and experienced Quality Executive to join ...
quality analysisquality managementquality auditquality inspectionquality checkquality assurancequality controlquality improvementmanufacturing

CDIP Traning with Placement For Medical coding
ISKILLS SOLUTIONS 1.00 to 10.00 Years Hyderabad, ThanjavurThanjavur, Bangalore, Tiruvannamalai, Chennai, Tiruchirappalli, Vellore, Dharmap 22 Jul, 2026

We are looking for motivated and detail-oriented candidates to join our CDIP (Clinical Documentation Integrity Practitioner) Training Program with placement assistance. This p...
physiotherapypharmacydentistrybhmsnursingmbbs

Urgent Openings- Medical Coding Freshers(BAMS,BHMS,BUMS,BSMS,BDS,BNYS)
ISKILLS SOLUTIONS 1.00 to 10.00 Years Guntur, ChennaiChennai, Hyderabad, Nellore, Vijayawada, Vishakhapatnam, Bangalore, Pune, Mumbai City 22 Jul, 2026

HR Bhavani- hidden_mobile (WhatsApp) Position: Medical Coder Medical Coding is the process of conversion of text information related to healthcare services into numer...
biotechnologybiomedical engineeringcardiologyphysiotherapyoptometrymicrobiologyradiologynuclear medicine technologycardio pulmonary perfusion care technology

Site Engineer
Roche International 1.00 to 10.00 Years Guntur, ChennaiChennai, Guntakal, Anantpur, Bangalore, Noida, Pune, Mumbai City, Delhi, AndamanNicob 22 Jul, 2026

1. Understand all facets of the waste water treatment operations and equipment Must be capable of running the plant effectively in the day to day operations and respond appropriately in emergency...
commissioner activitiesinstallationstpetp operationsite supervision

Public Health Nurse
Needs Ayurveda Private Limited 1.00 to 10.00 Years Vadodara, PatialaPatiala, Pune, Thiruvanananthapuram, Ooty, Kohima, Tuticorin, Bikaner, Muzzafarpur, 22 Jul, 2026

Job description We are looking for a highly skilled and compassionate Nurse to join our team at Medica Superspeciality Hospital (MSH). The ideal candidate will have a strong background in n...
patient assessmentmedication adherencewound caremedication administrationpatient caremedic activitiesemergency nursinginfection controlmedical records

Health Officer
Needs Ayurveda Private Limited 1.00 to 10.00 Years Thiruvananthapuram, DimapurDimapur, Indore, Ongole, Chennai, Kolkata, Gulbarga, Katihar, Muzzafarpur 22 Jul, 2026

Job description We are looking for Health Assistant to join our dynamic team and embark on a rewarding career journey. Responsible for supporting doctors and nurses in patient care activi...
health care servicesnursing practicequality of carepatient communicationspatient assessmentpatient carepatient monitoringpatient relations

Staff Nurse
DOCTORS DIAGNOSTIC NUCLEAR MEDICINE AND RESEARCH CENTRE PRIVATE LIMITED 1.00 to 10.00 Years Kottayam 22 Jul, 2026

Responsibilities: * Administer medications and treatments * Collaborate with healthcare team on patient care plans * Provide quality patient care under medical supervision * Monitor vital sig...
bsc nursingnursinggnm

Public Health Nurse
Needs Ayurveda Private Limited 1.00 to 10.00 Years Thiruvanananthapuram, PatialaPatiala, Pune, Ooty, Kohima, Tuticorin, Bikaner, Vadodara, Muzzafarpur, 22 Jul, 2026

Job description We are looking for a highly skilled and compassionate Nurse to join our team at Medica Superspeciality Hospital (MSH). The ideal candidate will have a strong background in n...
patient assessmentmedication adherencewound caremedication administrationpatient caremedic activitiesemergency nursinginfection controlmedical records

Quality Control Coordinator
FW FUTURESWINGS PRODUCTS & SERVICES (OPC) PRIVATE LIMITED 1.00 to 10.00 Years Kochi, KollamKollam, Bangalore, Jaipur, Chennai, Chittoor, Pondicherry, Belgaum, Mangalore, Mysore 22 Jul, 2026

A Quality Control Coordinator is a professional responsible for ensuring that a companys products or services meet established quality standards. This may include reviewing and inspecting product...
controlmanagementprocesssystemsqualityproblem-solvingprojectattentiondetail

Wanted Bsc/msc Nursing/gnm/staff nurse/female nurse,dgnm,anm
ACHIEVERS SPOT Hiring For Medical Coding 1.00 to 10.00 Years Erode, MaduraiMadurai, Coimbatore, Chennai, Ramanathapuram, Pudukottai, Salem, Vellore, Nagercoil, D 22 Jul, 2026

Position: Medical Coder Ct: HR Shanmugapriya hidden_mobile We are looking for a DGNM Staff nurse Shoul...
nursingbptpharmacistbiotechnology engineerspharmaceutical technologybiomedical engineersstaff nurse

Medical Coding
ACHIEVERS SPOT Hiring For MEDICAL CODING 1.00 to 10.00 Years Erode, MaduraiMadurai, Tiruchirappalli, Chennai, Thirunelveli, Salem, Nagercoil, Tuticorin, Cuddalor 22 Jul, 2026

Position:Medical Coder About Achievers Spot Medical Coding is the Fastest-growing Profession in the Healthcare Industry Today. It is a Niche Specialization and...
medical codingpharmacyphysiotherapymicrobiologybiotechnologybiomedicalnursingbioinformaticsmedical lab technology

Site Engineer
Roche International 1.00 to 10.00 Years Delhi, NoidaNoida, Guntur, Bangalore, Chennai, Guntakal, Pune, Mumbai City, AndamanNicobar, Anantpur 22 Jul, 2026

1. Understand all facets of the waste water treatment operations and equipment Must be capable of running the plant effectively in the day to day operations and respond appropriately in emergency...
commissioner activitiesinstallationstpetp operationsite supervision

Urgent Hiring-Biotechnology,Microbiology and Nursing Freshers for Medical Coding
ISKILLS SOLUTIONS 1.00 to 10.00 Years Delhi, GunturGuntur, Bangalore, Chennai, Vijayawada, Hyderabad, Kolkata, Vishakhapatnam, Pune, Mumba 22 Jul, 2026

HR Bhavani- hidden_mobile (WhatsApp) Position: Medical Coder Medical Coding is the process of conversion of text information related to healthcare services into numer...
cardiologybiotechnologygenetic engineeringneurologyradiologybiomedical engineeringmicrobiologynursingcritical care technology

Wanted Freshers in Neuro Electrophysiology Graduates For Medical Coding
ISKILLS SOLUTIONS 1.00 to 10.00 Years Chennai, ThanjavurThanjavur, Thirunelveli, Ramanathapuram, Salem, Tiruchirappalli, Thiruvarur, Krish 22 Jul, 2026

HR Bhavani - hidden_mobile (WhatsApp) Position: Medical Coder Medical Coding is the process of conversion of text information related to healthcare services into nume...
biomedical engineeringphysiotherapynursingmicrobiologyradiologyoptometrycardiologybiotechnologyneurology

Wanted B pharm Fresher For Medical Coding
ISKILLS SOLUTIONS 1.00 to 10.00 Years Chennai, VelloreVellore, Viluppuram, Tiruchengode, Thoothukudi, Salem, Nagercoil, Dindigul, Neyveli, 22 Jul, 2026

Role- Medical Coder: We are looking to hire an fresher Coder (B Pharm, Microbiology, Biology etc.)With strong domain expertise in CPT and ICD (diagnosis) coding, the incumbent should be able to v...
radiologycardiologyanesthesianursingdialysisbiologyzoologybiochemistry

Customer Service Manager Chennai
Talent Leads HR Solutions Pvt Ltd 1.00 to 10.00 Years Chennai 22 Jul, 2026

Key Responsibilities:

Handle end-to-end customer complaints received through the RBI CMS portal.

Act as the liaison between the organization, customers, and the RBI Ombudsman...
customer servicehome loans

Planning Engineer
V-hire Consultancy 1.00 to 10.00 Years Chennai, Vellore 22 Jul, 2026

Job Description Planning Engineer Position: Planning Engineer Location: Chennai & Vellore Experience: 3 and above Years Salary: Up to 50,000 - 60000 per month (Based on experience) Job Summary W...
planningplanning engineering

Audit Manager2
Vishwa karma 1.00 to 10.00 Years Bangalore 22 Jul, 2026

Conduct internal and external audits to evaluate financial records, processes, and compliance with company policies and regulation...
audio editingaudit report

Quality Control Coordinator
FW FUTURESWINGS PRODUCTS & SERVICES (OPC) PRIVATE LIMITED 1.00 to 10.00 Years Bangalore, MysoreMysore, Belgaum, Mangalore, Jaipur, Kochi, Chennai, Chittoor, Pondicherry, Kollam 22 Jul, 2026

A Quality Control Coordinator is a professional responsible for ensuring that a companys products or services meet established quality standards. This may include reviewing and inspecting product...
controlmanagementprocesssystemsqualityproblem-solvingprojectattentiondetail

Area sales Incharge at Bangalore
Talent Leads HR Solutions Pvt Ltd 1.00 to 10.00 Years Bangalore 22 Jul, 2026

Ensure rollout of FTTx and sales and gross additions in the designated territory. 1. Managing FTTX Business through multiple business Team members. 2. Appointment of Distributors and LCOs as chan...
channel salesb2c

Data Quality Analyst
AQUILASYS CONSULTANCY PRIVATE LIMITED 1.00 to 10.00 Years Bangalore, ChennaiChennai, Hyderabad, Pune, Mumbai City 22 Jul, 2026

Hi, This is Agnes from Aquilasys India Pvt Ltd. We are an IT Consulting and Staffing firm based at Mumbai We are looking for Senior Data Quality (100% remote). Please let me know if you are inter...
corporate actionssql

PREV
NEXT

nursing actions Job Openings

DESCRIPTION

DESCRIPTION

DESCRIPTION

DESCRIPTION

DESCRIPTION

DESCRIPTION

DESCRIPTION

Job Description

Key Responsibilities: Drive branch-level initiatives to achieve overall sales objectives. Monitor and ensure achievement of monthly and weekly sales targe... communication skillssales

Job description We are looking for a highly skilled and experienced Quality Executive to join ... quality analysisquality managementquality auditquality inspectionquality checkquality assurancequality controlquality improvementmanufacturing

We are looking for motivated and detail-oriented candidates to join our CDIP (Clinical Documentation Integrity Practitioner) Training Program with placement assistance. This p... physiotherapypharmacydentistrybhmsnursingmbbs

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Key Responsibilities:

Drive branch-level initiatives to achieve overall sales objectives.

Monitor and ensure achievement of monthly and weekly sales targe...
communication skillssales

Job description We are looking for a highly skilled and experienced Quality Executive to join ...
quality analysisquality managementquality auditquality inspectionquality checkquality assurancequality controlquality improvementmanufacturing

We are looking for motivated and detail-oriented candidates to join our CDIP (Clinical Documentation Integrity Practitioner) Training Program with placement assistance. This p...
physiotherapypharmacydentistrybhmsnursingmbbs