offering financial advice jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

offering financial advice Job Openings

Showing 12001 - 12050 of 34388 Jobs

Financial Management

M/S AASTHA LIFECARE CORPORATION PRIVATE LIMITED 11.00 to 21.00 Years Hyderabad,Bangalore, Chennai, Kolkata, Gurugram, West Siang, Bhillai, Silvassa, Port Blair, Dibrugar 01 Apr, 2025

Pre Sales Executive

DIGITALCUBE CONSULTANCY SERVICES PRIVATE LIMITED 1.00 to 3.00 Years Hyderabad,Delhi 01 Apr, 2025

Designation:

Experience Required:

Location: presalestele sales

Part Time Computer , Back Office Executive, Typist, Typing, Online Data Entry
Ruppan India Nidhi Limited 0.00 to 1.00 Years Hyderabad,Bangalore, Noida, Chennai, Gurugram, Kolkata, Pune, Mumbai City, Delhi, Patna 01 Apr, 2025

We are offering a Job. Data Entry Operator, Computer Operator, Back Office Executive, Typist Freshers and Experienced both can apply for this jobs. Position- Data Entry Executi...
part timeback officeonline work from homedata entry typinghome based data entrywork from homedata entryonline data entrydata entryin

Customer Care Representative
Hucon Solutions India PvtLtd 1.00 to 5.00 Years Hyderabad 01 Apr, 2025

GREETING FROM HUCON SOLUTIONS Hiring for MNCs Process: International Voice Process Job Details:International Voice Process Location:Hyderabad Eligibility Criteria Minimum 8 months to 3 yea...
semi voice processcustomer servicevoice process

Hospital Manager
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 13.00 to 18.00 Years Hyderabad,Bangalore, Kochi, Chennai, Gurugram, Kolkata, Kollam, Thiruvanananthapuram, Mumbai City, D 01 Apr, 2025

We are looking for an experienced Hospital Administration Manager to run our medical facility. To be successful in this role, you should have a deep understanding of all administrative hospital ...
problemmanagementbudgetingassurancecollaborationcommunicationqualityfinancialsolving

Agency Development Manager
RELIANCE NIPPON LIFE INSURANCE COMPANY LIMITED 0.00 to 4.00 Years Hyderabad 01 Apr, 2025

We are pleased to offer you the chance to advance your career with one of Indias top three most trusted life insurance brands, as recognized in the Brand Equity Most Trusted Brands Survey 2018. W...
insurance agency managementchannel partnersdirect salesagency sales

Part Time , Data Entry , Online Typing , Home Based , Work From Home
Ruppan India Nidhi Limited 0.00 to 1.00 Years Gwalior,Jabalpur, Kurnool, Jodhpur, Vapi, Kota, Vijayawada, Thrissur, Ambala, Cuddalore 01 Apr, 2025

We are offering a Job. Part Time Jobs, Data Entry Work, Online Computer Work, Work From Home, Back Office Executive, Typist, Online Typing Jobs Freshers and Experienced both can apply for this j...
data entry typingpart timework from homeback officeonline data entrydata entrycontent writingcomputer operatingonline work from home

Requirement in Agency Development manager for Life Insurance CTc upto 5.5 lacs
ATS Infovision 3.00 to 8.00 Years Gwalior,Bhopal, Jabalpur, Solapur, Rajkot, Pune, Aurangabad, Surat, Nagpur 01 Apr, 2025

Dear Candidates, Greetings of the day! Candidate Qualifications:

Previous Sales Experience: Proven success in a sales role, prefe...
agency developmentagent recruitmentunit manager

Sr.Finance Manager
Confidential 10.00 to 15.00 Years Gurugram 01 Apr, 2025

We are Hiring for Senior Finance Manager - SahiBandhu FinTech Services ( The Manipal Group) About Us:- SahiBandhu is Indias leading gold loan platform backed b...
gaapbenefits realisationcash flowrisk managementfinancial analysiserpfinancial reportingstakeholder managementerp software

Accountant
PLACEMENT EXPERT Hiring For Congo DRC 4.00 to 9.00 Years Gurugram,Delhi, Bangalore, Chennai, Hyderabad, Vijayawada, Pune, Mumbai City 01 Apr, 2025

We have a requirement for Accountant with our client which Internet service provider in Kinshasa, Democratic Republic of the Congo. Position: Accountant englishaccounting

Marketing Executive
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 14.00 to 24.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Bhagalpur, Hyderabad, Pune, Patna, Guwahati 01 Apr, 2025

Marketing executives coordinate and oversee campaigns geared at promoting products, services, and causes. Marketing executives are adept at a variety of platforms, including print and social med...
marketing researchmarketing communicationmarketing managementbrand managementmarketing

Automotive Engineer
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 14.00 to 24.00 Years Gurugram,Delhi, Noida, Jaipur, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Guwahati 01 Apr, 2025

Job brief We are looking for a skilledAuto Mechanicto maintain and repair vehicles. You will be responsible for troubleshooting issues and fixing them aiming to maximum relia...
constructionautomobile engineeringautomobileconstruction managementengineering management

Hiring For Online Marketing Executive (Work From Home Or Office Both) DELHI-NCR
Desnor Destination Pvt Ltd 0.00 to 4.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida 01 Apr, 2025

Dear Candidate Greetings fromDesnor Destination Pvt Ltd ! Job Summary Idealises Internet Marketing Agency is looking for Marketing Executive to join our dynamic team and embark on a rewarding...
marketing planningdigitaldisplay advertisingmarketingfreelancingwork from homemarketing communicationpart time

Accounting Specialist
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 3.00 to 7.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Pune, Mumbai City 01 Apr, 2025

Check figures, postings, and documents for accuracy. Organize, secure, and maintain all files, records, cash and cash equivalents in accordance with policies and procedures. Record, store, access...
qualitystandardsbillingaccountingfinance executivementorsupervisorpayrollfinancial

Business Development Manager
ADITYA BIRLA SUN LIFE INSURANCE COMPANY LIMITED 1.00 to 2.00 Years Gurugram,Delhi, Faridabad, Ghaziabad 01 Apr, 2025

Designation:Agency Manager Education:Any Graduates Experience:Fresher with Good network / Min. 1 Yearin anyDomain Sal...
salesinsuranceagency channelbfsi sales

NTT DATA Virtual Drive Hedge Fund Gurgaon
NTT DATA INFORMATION PROCESSING SERVICES PRIVATE LIMITED 1.00 to 3.00 Years Gurugram 01 Apr, 2025

NTT DATA is Hiring experienced candidates for Hedge Fund Accounting domain. Location:Gurgaon Sector 48 (Candor Techspace) Work from Office Only Shift ...
reconciliationhedge fundsnav calculationinvestment banking

Hospital Manager
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 13.00 to 18.00 Years Gurugram,Delhi, Bangalore, Kochi, Chennai, Hyderabad, Kolkata, Kollam, Thiruvanananthapuram, Mumbai 01 Apr, 2025

We are looking for an experienced Hospital Administration Manager to run our medical facility. To be successful in this role, you should have a deep understanding of all administrative hospital ...
problemmanagementbudgetingassurancecollaborationcommunicationqualityfinancialsolving

Online Work From Home, Data Entry Typing , Computer Operator Typist Part Time
Ruppan India Nidhi Limited 0.00 to 1.00 Years Kochi,Madurai, Raipur, Rajkot, Faridabad, Jalandhar, Ludhiana, Nagpur, Bhopal, Erode 01 Apr, 2025

We are offering a Job. Part Time Jobs, Data Entry Work, Online Computer Work, Work From Home, Back Office Executive, Typist Freshers and Experienced both can apply for this jobs. Positi...
part timeonline work from homedata entry typinghome based data entrydata entryonline data entry

Hospital Manager
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 13.00 to 18.00 Years Kochi,Kollam, Thiruvanananthapuram, Bangalore, Chennai, Hyderabad, Gurugram, Kolkata, Mumbai City, D 01 Apr, 2025

We are looking for an experienced Hospital Administration Manager to run our medical facility. To be successful in this role, you should have a deep understanding of all administrative hospital ...
problemmanagementbudgetingassurancecollaborationcommunicationqualityfinancialsolving

Need Freelancer - Data Entry Operator - Work At Home, Apply Now
VISHWANATH ENTERPRISES 0.00 to 2.00 Years Ernakulam,Thrissur, Chennai, Hyderabad, Vishakhapatnam, Kolkata, Pune, Chandigarh, Hubli, Bhopal 01 Apr, 2025

Dear candidate, We are looking for freshers and experienced candidates for work from home We are offering a Job Part Time Jobs Data Entry Work Online Computer Work Work From Home Back Office Ex...
typing speeddata entrywriting skillspart time

Audit Associate
Emrys Creatives 3.00 to 7.00 Years Kozhikode,Other Kerala 01 Apr, 2025

Company Description EMRYS Global LLC offers professional services in tax, accounts audit, legal consulting, and outsourcing. The company provides clever solutions for various financial problems u...
financial statement analysisfinancial auditsanalytical skills

E2E CNX Architect / CNX Solution Architect
Infosys Limited 4.00 to 8.00 Years Other Kerala,Thiruvananthapuram 01 Apr, 2025

Key Responsibilities: A day in the life of an Infoscion As part of the Infosys consulting team your primary role would be to lead the engagement effort of providing high quality and value adding...
AWSDevOpsGoogle Cloud PlatformKubernetesTelecomSDLCAgile MethodologiesProject ManagementTeam ManagementAgile CoachBusiness Analyst

Hotel cashier
Addon Jobs 2.00 to 6.00 Years Kochi,Other Kerala 01 Apr, 2025

Welcoming customers, answering their questions, helping them locate items, and providing advice or recommendations. Candidate will needed cashier experience for hotel field. Operating scanners, ...
Cashiering

Country Head/ Destination Head/ Country Lead for UK & Ireland
Leadz Study Abroad 2.00 to 6.00 Years Kochi,Other Kerala 01 Apr, 2025

Company Description Leadz Study Abroad specializes in helping students achieve their dreams of studying in top destinations like the UK, Ireland, the USA, France, Latvia, Malta, Germany, Spain, C...
Management skillsInterpersonal skillsCommunication skillsStrong leadershipKnowledge of UK

Financial Controller
GF HOTELS AND RESORTS 10.00 to 14.00 Years Other Kerala 01 Apr, 2025

Responsibilities Maintaining internal controls over financial reporting Presenting financial reports to an executive team Overseeing the preparation of budgets Managing accounting records Eva...
Financial reportingBudget preparationRisk managementRegulatory complianceFinancial statementsFinancial reportsAccounting records managementFinancial data analysisAuditing processes coordination

Part Time , Data Entry , Online Typing , Home Based , Work From Home
Ruppan India Nidhi Limited 0.00 to 1.00 Years Thrissur,Gwalior, Kurnool, Jabalpur, Jodhpur, Vapi, Kota, Vijayawada, Ambala, Cuddalore 01 Apr, 2025

We are offering a Job. Part Time Jobs, Data Entry Work, Online Computer Work, Work From Home, Back Office Executive, Typist, Online Typing Jobs Freshers and Experienced both can apply for this j...
data entry typingpart timework from homeback officeonline data entrydata entrycontent writingcomputer operatingonline work from home

Divisional Manager
TEAMWORK CABLES PRIVATE LIMITED 16.00 to 25.00 Years Kannur,Kasargod, Kottayam, Kozhikode, Malappuram, Thiruvanananthapuram, Bangalore, Chennai, Mangalor 01 Apr, 2025

The Division Manager plays a vital role in overseeing and managing the operations of an entire division within the company. This position requires a blend of strategic oversight, operational manag...
foreign assistanceindustrial policymanagerial economicstrade negotiationoperating agreementsindustrial economicstrade agreementsdivision ordersmanager

Finance Administration Analyst
ASSETCARE SERVICES PRIVATE LIMITED 1.00 to 5.00 Years Kottayam,Bangalore, Chennai, Ghaziabad, Hyderabad, Kolkata, Gurugram, Faridabad, Mangalore, Ahmedaba 01 Apr, 2025

Financial Management Analysts examine budget estimates for completeness, accuracy, and conformance with procedures and regulations. Analyze budgeting and accounting reports. Afinancial analyst tr...
analysissoftwareaccountingdataexcelcommunicationcollaborationmodelingspreadsheetfinancialmathematical

Urgent Hiring for Civil Engineer Fresher
Karnataka Information Solution 0.00 to 4.00 Years Kochi,Bangalore, Chennai, Hyderabad 01 Apr, 2025

Description Qualification : BE / BTech Civil Job Types: Full-time, Fresher, Experienced Salary: 25,000.00 - 50,000.00 per month Manage, design, develop, create and maintain projects Conduct o...
civil constructioncivil designconstruction siteconstruction drawingsautocadconstruction safetysite engineeringconstruction estimatingcost estimation

Audit Manager
M/S B NANDI 14.00 to 24.00 Years Delhi,Noida, Oman, Itanagar, South America, Saudi Arabia, Kuwait, Mauritius, Bangalore, Philippines, 01 Apr, 2025

We are looking for an organized, analytical auditor to help us examine our current policies and procedures and help us develop strategies to improve our internal control systems. The Auditor will...
examinationdocumentationinformation processingevaluationauditory processingreportinganalyze information

Equity Dealer
Apex Services Hiring For One of the leading broking firm 2.00 to 5.00 Years Delhi,Faridabad, Noida, Jaipur, Jodhpur, Gurugram 01 Apr, 2025

JD Relationship Manager- Dealing:- As part of the retail distribution team, the role holder is responsible to provide compliant financial advisory services to clients and...
dematnismcross sellingstock market

Urgent Hiring for Personal Loan Sales Executive
AASAANJOBS PRIVATE LIMITED Hiring For AASAANJOBS PRIVATE LIMITED 1.00 to 5.00 Years Delhi 01 Apr, 2025

A well-defined job description sets clear expectations and attracts suitable candidates. Below is a template tailored for a Loan Sales Executive role: Job T...
loan salespersonal loans

Hospital Manager
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 13.00 to 18.00 Years Delhi,Bangalore, Kochi, Chennai, Hyderabad, Gurugram, Kolkata, Kollam, Thiruvanananthapuram, Mumbai 01 Apr, 2025

We are looking for an experienced Hospital Administration Manager to run our medical facility. To be successful in this role, you should have a deep understanding of all administrative hospital ...
problemmanagementbudgetingassurancecollaborationcommunicationqualityfinancialsolving

ICICI Bank Aspire Program
ICICI Bank Ltd 0.00 to 1.00 Years Delhi,Noida, Bangalore, Chennai, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City 01 Apr, 2025

About the Company ICICI Bank Ltd, is one of Indias leading private bank offering a wide range of financial services. Established in 1994, it is headquartered in Mumbai and has ...
salesrelationship managementmanagement

Business Development Manager
ADITYA BIRLA SUN LIFE INSURANCE COMPANY LIMITED 1.00 to 2.00 Years Delhi,Faridabad, Ghaziabad, Gurugram 01 Apr, 2025

Designation:Agency Manager Education:Any Graduates Experience:Fresher with Good network / Min. 1 Yearin anyDomain Sal...
salesinsuranceagency channelbfsi sales

Team Manager
ASHISH INVESTMENT SERVICES 15.00 to 25.00 Years Delhi 01 Apr, 2025

Profile: Associate Agency Development About the Company: Kotak Mahindra Life Insuranceis a fast-growing organization recognized for its100%succ...
salesbusiness developmentteam managementlead generation

Urgent Opening- Financial Planning & Analyst- Manufacturing Industry- Delhi
Topgear Consultants Private Limited 2.00 to 7.00 Years Delhi 01 Apr, 2025

Hiring with a leading Manufacturing industry for their office in Delhi. Role: Financial planning & Analysis Qualification - MBA/CA Location: Delhi analysisfinancial planningbudgetingplanningvariance analysisforecastingmodelling

Part Time Computer , Back Office Executive, Typist, Typing, Online Data Entry
Ruppan India Nidhi Limited 0.00 to 1.00 Years Delhi,Noida, Bangalore, Chennai, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City, Patna 01 Apr, 2025

We are offering a Job. Data Entry Operator, Computer Operator, Back Office Executive, Typist Freshers and Experienced both can apply for this jobs. Position- Data Entry Executi...
part timeback officeonline work from homedata entry typinghome based data entrywork from homedata entryonline data entrydata entryin

Hospital Manager
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 13.00 to 18.00 Years Delhi,Bangalore, Kochi, Chennai, Hyderabad, Gurugram, Kolkata, Kollam, Thiruvanananthapuram, Mumbai 01 Apr, 2025

We are looking for an experienced Hospital Administration Manager to run our medical facility. To be successful in this role, you should have a deep understanding of all administrative hospital ...
problemmanagementbudgetingassurancecollaborationcommunicationqualityfinancialsolving

Senior Architect
Rajdeep and Company Infrastructure Pvt Ltd 3.00 to 7.00 Years Chandigarh 01 Apr, 2025

Key Responsibilities: 1. Design and Planning: Develop architectural designs and plans for various projects including residential, commercial, and industrial structures. Conduct feasibility stud...
Technical SkillsProject ManagementCommunication

Need Freelancer - Data Entry Operator - Work At Home, Apply Now
VISHWANATH ENTERPRISES 0.00 to 2.00 Years Chandigarh,Ernakulam, Chennai, Hyderabad, Vishakhapatnam, Kolkata, Pune, Thrissur, Hubli, Bhopal 01 Apr, 2025

Dear candidate, We are looking for freshers and experienced candidates for work from home We are offering a Job Part Time Jobs Data Entry Work Online Computer Work Work From Home Back Office Ex...
typing speeddata entrywriting skillspart time

Audit Manager
M/S B NANDI 14.00 to 24.00 Years Chandigarh,Oman, Itanagar, South America, Saudi Arabia, Kuwait, Mauritius, Bangalore, Noida, Philipp 01 Apr, 2025

We are looking for an organized, analytical auditor to help us examine our current policies and procedures and help us develop strategies to improve our internal control systems. The Auditor will...
examinationdocumentationinformation processingevaluationauditory processingreportinganalyze information

Hr Recruiter Intern
KKD Consulting Hiring For KKD 0.00 to 4.00 Years Chandigarh,Mohali, Panchkula, Noida, Ghaziabad, Gurugram, Sonipat, Faridabad, Delhi, Manesar 01 Apr, 2025

Job Title: HR Recruiter Intern Company: KKD CONSULTING Location: callingrecruitment

Online Data Entry Operator, Data Entry Clerk, Data Entry Typing
Ruppan India Nidhi Limited 0.00 to 1.00 Years Chandigarh,Bhubaneswar, Jaipur, Indore, Navi Mumbai, Thane, Surat, Coimbatore, Ahmedabad, Guwahati 01 Apr, 2025

We are offering a Job. Data Entry Operator, Computer Operator, Back Office Executive, Typist Freshers and Experienced both can apply for this jobs. Position- Data Entry Execut...
data entry typingpart timework from homeonline data entrydata entrycontent writingonline work from home

Online Work From Home, Data Entry Typing , Computer Operator Typist Part Time
Ruppan India Nidhi Limited 0.00 to 1.00 Years Chandigarh,Bhubaneswar, Jaipur, Indore, Navi Mumbai, Thane, Surat, Coimbatore, Ahmedabad, Guwahati 01 Apr, 2025

We are offering a Job. Part Time Jobs, Data Entry Work, Online Computer Work, Work From Home, Back Office Executive, Typist Freshers and Experienced both can apply for this jobs. Positi...
online work from homedata entry typinghome based data entrydata entryonline data entry

Software Developer - .NET Core - Coimbator
Forar Tech India Private Limited 3.00 to 7.00 Years Coimbatore,Other Tamil Nadu 01 Apr, 2025

Company Overview Forar Tech India Private Limited is a premium IT services company that specializes in technology staffing. We are known for our ability to find the most qualified candidates with...
SQL Server Management StudioBootstrapJavaScriptjQueryGitASPNET CoreASPNET MVC

Semi voice processing
Markdot Intellect 0.00 to 3.00 Years Coimbatore,Other Tamil Nadu 01 Apr, 2025

Company Description Markdot Intellect is committed to providing exceptional service to customers while offering the best training to its team. The company is located in Coimbatore. Role Descript...
Strong verbalwritten communication skillsAbility to handle customer inquiriesresolve issues effectivelyAttention to detail

Lead - Engineering Development
Milacron 3.00 to 9.00 Years Coimbatore,Other Tamil Nadu 01 Apr, 2025

Position : - CAD Engineering Development Job Type : - Full time employment Experience : - 5-9 years of experience As a CAD Application Engineer, youll be responsible for ensuring that our CAD s...
SolidWorksAutoCAD3D ModelingTechnical SupportEngineering DesignTroubleshootingDocumentation

Brand Ambassador
The Ripples 0.00 to 4.00 Years Coimbatore,Other Tamil Nadu 01 Apr, 2025

Ripples Internship Opportunity Be a Brand Ambassador! About Ripples At Ripples, we innovate, ideate, and create Next Gen Leaders. We believe in people, and thats how our thriving community of 1...
Community EngagementEvent Management

Internal Auditor
WorkMint 0.00 to 4.00 Years Coimbatore,Thanjavur, Madurai, Thirunelveli, Salem, Tiruchirappalli, Nagercoil, Ooty, Erode, Cuddalo 01 Apr, 2025

WorkMint Hiring For Banking Internal Auditor Job Description conduct thorough financial audits, analyse data, identify discrepancies and provide rec...
audit planningauditingaudit management

PREV
NEXT

offering financial advice Job Openings

Job brief We are looking for a skilledAuto Mechanicto maintain and repair vehicles. You will be responsible for troubleshooting issues and fixing them aiming to maximum relia... constructionautomobile engineeringautomobileconstruction managementengineering management

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Job brief We are looking for a skilledAuto Mechanicto maintain and repair vehicles. You will be responsible for troubleshooting issues and fixing them aiming to maximum relia...
constructionautomobile engineeringautomobileconstruction managementengineering management