preparing financial projections jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

preparing financial projections Job Openings

Showing 11151 - 11200 of 34378 Jobs

Opening Senior Accountant

TALENT MAX HR & MANGAGEMENT CONSULTANT 10.00 to 15.00 Years Indore 01 Apr, 2025

Job Opening: Senior Accountant

Location:

Experience: income tax actaccounting standardsdirect tax

Equity Research Analyst
Jobsense 1.00 to 3.00 Years Indore 01 Apr, 2025

We are a hardcore research, analytics provider. Started building a track record of growth, a culture of innovative solutions which sets us apart. We are delivering our opinions, actionable insigh...
fundamental analysisequity valuationequity researchqualitative analysisfinancial modelingequity analysis

Relationship Manager
DREAMS SOLUTIONS 0.00 to 3.00 Years Indore 01 Apr, 2025

We hiring For Relationship Manager And Advisor For -INDORE/ NOIDA/ MUMBAI Experince-6 Month to 2 year Key Responsibilities...
salesdirect marketingdemat accounts

Procurement Assistant
SHARMA ENTERPRISES 1.00 to 6.00 Years Indore,Gwalior, Bhopal, Ernakulam, Kochi, Bokaro, Malappuram, Kozhikode, Thrissur, Ranchi 01 Apr, 2025

We are currently searching for a Procurement Assistant supports the purchasing and supply chain processes, assisting with tasks like sourcing suppliers, preparing purchase orders, maintaining pro...
purchase operationssupplier quality assurancesourcing materialsinventory managementrecord maintenancedata analysisrecord keeping

Human Resources (HR) Internship in Indore.
Bright Future Placement Hiring For BRIGHT FUTURE PLACEMENT 0.00 to 1.00 Years Indore 01 Apr, 2025

Human Resources (HR) (Indore) Start Date- 8-MARCH25 Immediately Duration 3 Months Stipend RS-5,000 / Total .APPLY
About the internship Se...
mba freshersmba hr

Warehouse Supervisor
SHARMA ENTERPRISES 1.00 to 6.00 Years Indore,Gwalior, Bhopal, Bishnupur, Imphal, Shillong, Imphal West, Senapati, Churachandpur, Thoubal 01 Apr, 2025

We are looking for an experienced warehouse supervisor to manage and oversee all warehouse activities, ensure efficient processes, and maximize warehouse productivity. The warehouse supervisors r...
performancesupervisioninventorysafetymonitoringleadership

Pipeline Engineer
Garima Interprises 1.00 to 6.00 Years Hyderabad,Australia, Austria, Canada, Other AndamanNicobar, Port Blair, Bangalore, Chennai, Noida, U 01 Apr, 2025

Pipeline Engineer Job Description Template We are looking for a highly experienced pipeline engineer to design and develop a variety of pipeline...
budgetingblueprintcommunicationrepairconstruction technologytechnical standards

Payroll Coordinator
M/S B NANDI 10.00 to 20.00 Years Hyderabad,China, Qatar, South Africa, Tambaram, Bhubaneswar, Bangalore, Jaipur, United Arab Emirates 01 Apr, 2025

We are looking for a payroll coordinator to manage all payroll activities and ensure the timely and accurate payment of employee wages. The payroll coordinator will ensure the collection of all n...
transfer pricing analysisbenefitsrecord keepingpromotionspayroll managementpaychex

Accountant
PLACEMENT EXPERT Hiring For Congo DRC 4.00 to 9.00 Years Hyderabad,Bangalore, Chennai, Vijayawada, Gurugram, Pune, Mumbai City, Delhi 01 Apr, 2025

We have a requirement for Accountant with our client which Internet service provider in Kinshasa, Democratic Republic of the Congo. Position: Accountant englishaccounting

Male Front Office - MEHEDIPATNAM, KPHB
AURA HEARING CARE PRIVATE LIMITED 1.00 to 4.00 Years Hyderabad 01 Apr, 2025

To welcome & Assist Customer on their arrival in clinics.

Take down customers details and information. (Forms and official Templates to be filled).

Confir...
cash receiptsms officeinvoice processingbillingpetty cash

Farm Supervisor
YOUTAG INFOTECH PRIVATE LIMITED 15.00 to 24.00 Years Hyderabad,Bangladesh, Chirang, Guwahati, Bangalore, Bhagalpur, Chennai, Nagaon, Sivasagar, Pune, Dhu 01 Apr, 2025

We are searching for a manager with good business sense to join our team. The farm managers responsibilities include monitoring staff, crops, and livestock, purchasing supplies, preparing budgets...
farm equipmentdeerfarmingfarmlandnunchuku skillshunting landbowhuntingfarmers

Staff Transaction Processing
YOUTAG INFOTECH PRIVATE LIMITED 15.00 to 24.00 Years Hyderabad,Kurung Kumey, Bangalore, Tarapur, Kadapa, Cachar, Pune, East Kameng, Itanagar, Other Andam 01 Apr, 2025

Join Accenture and help transform leading organizations and communities around the world. The sheer scale of our capabilities and client engagements and the way we collaborate, operate and delive...
staff retentionstaff assessmentstaff developmentstaff schedulingstaff managementstaff relationsstaff training

Urgent Opening for Frontline Sales Associate for Insurance Domain
SPECTRUM INSURANCE BROKING PRIVATE LIMITED 1.00 to 3.00 Years Hyderabad,Bangalore, Mohali, Chennai, Kolkata, Gurugram, Pune, Mumbai City, Itanagar, Other Arunacha 01 Apr, 2025

As a Front Line Sales (FLS) employee in Agency channel, you will leverage your network to recruit Financial Consultant (Agents) and coach them to sell life insurance policies and service customer...
direct salesb2b salesb2c salesinsurance salesclient servicinglife insurancebfsi saleslead generation

We are hiring for Frontline Sales Associate for Insurance Domain
SPECTRUM INSURANCE BROKING PRIVATE LIMITED 0.00 to 3.00 Years Hyderabad,Bangalore, Srikakulam, Ongole, Chennai, Vizianagaram, Guntakal, Kolkata, Mumbai City, Anan 01 Apr, 2025

Are you good at networking and training teams If yes, then this is the right job for you! As a Front Line Sales (FLS) employee in Agency channel, you will leverage your network to recruit Finan...
life insurancesalesclient servicinglead generationbfsi salesb2b salesinsurance salesb2c sales

Financial Management
M/S AASTHA LIFECARE CORPORATION PRIVATE LIMITED 11.00 to 21.00 Years Hyderabad,Bangalore, Chennai, Kolkata, Gurugram, West Siang, Bhillai, Silvassa, Port Blair, Dibrugar 01 Apr, 2025

A Financial Manager oversees an organizations financial health, creating reports, managing investments, developing financial strategies, and ensuring compliance with regulations, all while advisi...
managementaccountsbusinessstrategyreceivableanalysisaccounting

Labourer
ASSETCARE SERVICES PRIVATE LIMITED 1.00 to 5.00 Years Hyderabad,Bangalore, Noida, Ongole, Chennai, Ghaziabad, Gurugram, Kolkata, Faridabad, Patna 01 Apr, 2025

General laborers perform manual duties set out by supervisors. General laborers responsibilities include working with power tools, maintaining a clean work environment and receiving goods. ALabor...
communicationtechnologyliteracybasicinstructionsnumeracyfollowskillsstamina

Pharmacovigilance Associate
CLIN BIOSCIENCES 0.00 to 1.00 Years Hyderabad,Bangalore, Pune, Mumbai City 01 Apr, 2025

Roles and Responsibilities

Adverse event collection and reporting: Receiving and reviewing adverse event reports fro...
argus safetyarisgdrug safety

Pre Sales Executive
DIGITALCUBE CONSULTANCY SERVICES PRIVATE LIMITED 1.00 to 3.00 Years Hyderabad,Delhi 01 Apr, 2025

Designation:Pre-Sales Executive Experience Required:6month to 2years Location: presalestele sales

Warehouse Manager
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 9.00 Years Hyderabad,Bangalore, Chennai, Gurugram, Delhi 01 Apr, 2025

Responsibilities and Duties Preparing documents related to dispatch such as invoices, shipping-labels, picklists etc Picking products from the warehouse for each batch Getting the products packed...
transportwarehouse managementlogistics managementwarehouse clerkpacking materialslogistics freight station warehousingwarehouse managersupply chainswarehouse logistics

Hospital Manager
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 13.00 to 18.00 Years Hyderabad,Bangalore, Kochi, Chennai, Gurugram, Kolkata, Kollam, Thiruvanananthapuram, Mumbai City, D 01 Apr, 2025

We are looking for an experienced Hospital Administration Manager to run our medical facility. To be successful in this role, you should have a deep understanding of all administrative hospital ...
problemmanagementbudgetingassurancecollaborationcommunicationqualityfinancialsolving

Agency Development Manager
RELIANCE NIPPON LIFE INSURANCE COMPANY LIMITED 0.00 to 4.00 Years Hyderabad 01 Apr, 2025

We are pleased to offer you the chance to advance your career with one of Indias top three most trusted life insurance brands, as recognized in the Brand Equity Most Trusted Brands Survey 2018. W...
insurance agency managementchannel partnersdirect salesagency sales

Requirement in Agency Development manager for Life Insurance CTc upto 5.5 lacs
ATS Infovision 3.00 to 8.00 Years Gwalior,Bhopal, Jabalpur, Solapur, Rajkot, Pune, Aurangabad, Surat, Nagpur 01 Apr, 2025

Dear Candidates, Greetings of the day! Candidate Qualifications:

Previous Sales Experience: Proven success in a sales role, prefe...
agency developmentagent recruitmentunit manager

Procurement Assistant
SHARMA ENTERPRISES 1.00 to 6.00 Years Gwalior,Indore, Bhopal, Ernakulam, Kochi, Bokaro, Malappuram, Kozhikode, Thrissur, Ranchi 01 Apr, 2025

We are currently searching for a Procurement Assistant supports the purchasing and supply chain processes, assisting with tasks like sourcing suppliers, preparing purchase orders, maintaining pro...
purchase operationssupplier quality assurancesourcing materialsinventory managementrecord maintenancedata analysisrecord keeping

Warehouse Supervisor
SHARMA ENTERPRISES 1.00 to 6.00 Years Gwalior,Indore, Bhopal, Bishnupur, Imphal, Shillong, Imphal West, Senapati, Churachandpur, Thoubal 01 Apr, 2025

We are looking for an experienced warehouse supervisor to manage and oversee all warehouse activities, ensure efficient processes, and maximize warehouse productivity. The warehouse supervisors r...
performancesupervisioninventorysafetymonitoringleadership

Pipeline Engineer
Garima Interprises 1.00 to 6.00 Years Gurugram,Delhi, Noida, Australia, Austria, Canada, Other AndamanNicobar, Port Blair, Bangalore, Chen 01 Apr, 2025

Pipeline Engineer Job Description Template We are looking for a highly experienced pipeline engineer to design and develop a variety of pipeline...
budgetingblueprintcommunicationrepairconstruction technologytechnical standards

Sr.Finance Manager
Confidential 10.00 to 15.00 Years Gurugram 01 Apr, 2025

We are Hiring for Senior Finance Manager - SahiBandhu FinTech Services ( The Manipal Group) About Us:- SahiBandhu is Indias leading gold loan platform backed b...
gaapbenefits realisationcash flowrisk managementfinancial analysiserpfinancial reportingstakeholder managementerp software

Accountant
PLACEMENT EXPERT Hiring For Congo DRC 4.00 to 9.00 Years Gurugram,Delhi, Bangalore, Chennai, Hyderabad, Vijayawada, Pune, Mumbai City 01 Apr, 2025

We have a requirement for Accountant with our client which Internet service provider in Kinshasa, Democratic Republic of the Congo. Position: Accountant englishaccounting

Urgent | Hiring for Admission Head for Corporate Pre school at Gurugram
HR Globe Recruitment Service 3.00 to 8.00 Years Gurugram 01 Apr, 2025

Dear Candidates, Urgent | Hiring for Admission Head for Corporate Pre school at Gurugram Salary upto 55k Interested candidates please call hr on hidden_mobile 1. Me...
parent communicationcounsellinglead generationpreschoolonline lead generation

Materials Manager
SHARMA ENTERPRISES 3.00 to 8.00 Years Gurugram,Faridabad, Bhiwani, Hisar, Karnal, Kurukshetra, Panchkula, Ambala, Panipat, Kolkata 01 Apr, 2025

We are searching for a qualified materials manager to oversee our inventory and purchasing operations. If you are an experienced and competent individual with in-depth knowledge of inventory mana...
inventory managementmaterials managementmaterial procurementsourcing strategylogistics managementmanufacturingpurchase managementprocurement

Quantity Surveyor
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 14.00 to 24.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City, Guwahati 01 Apr, 2025

Also known as cost consultants, quantity surveyors ensure building projects remain within budget. They provide cost and material estimates, draw up projected budgets, and work alongside a team, ...
quality managementquantity analysisquantity surveyingquality assurancequantity estimationquality control

Marketing Executive
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 14.00 to 24.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Bhagalpur, Hyderabad, Pune, Patna, Guwahati 01 Apr, 2025

Marketing executives coordinate and oversee campaigns geared at promoting products, services, and causes. Marketing executives are adept at a variety of platforms, including print and social med...
marketing researchmarketing communicationmarketing managementbrand managementmarketing

Hiring For Online Marketing Executive (Work From Home Or Office Both) DELHI-NCR
Desnor Destination Pvt Ltd 0.00 to 4.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida 01 Apr, 2025

Dear Candidate Greetings fromDesnor Destination Pvt Ltd ! Job Summary Idealises Internet Marketing Agency is looking for Marketing Executive to join our dynamic team and embark on a rewarding...
marketing planningdigitaldisplay advertisingmarketingfreelancingwork from homemarketing communicationpart time

Accounting Specialist
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 3.00 to 7.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Pune, Mumbai City 01 Apr, 2025

Check figures, postings, and documents for accuracy. Organize, secure, and maintain all files, records, cash and cash equivalents in accordance with policies and procedures. Record, store, access...
qualitystandardsbillingaccountingfinance executivementorsupervisorpayrollfinancial

Labourer
ASSETCARE SERVICES PRIVATE LIMITED 1.00 to 5.00 Years Gurugram,Faridabad, Ghaziabad, Noida, Bangalore, Ongole, Chennai, Hyderabad, Kolkata, Patna 01 Apr, 2025

General laborers perform manual duties set out by supervisors. General laborers responsibilities include working with power tools, maintaining a clean work environment and receiving goods. ALabor...
communicationtechnologyliteracybasicinstructionsnumeracyfollowskillsstamina

Business Development Manager
ADITYA BIRLA SUN LIFE INSURANCE COMPANY LIMITED 1.00 to 2.00 Years Gurugram,Delhi, Faridabad, Ghaziabad 01 Apr, 2025

Designation:Agency Manager Education:Any Graduates Experience:Fresher with Good network / Min. 1 Yearin anyDomain Sal...
salesinsuranceagency channelbfsi sales

Warehouse Manager
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 9.00 Years Gurugram,Delhi, Bangalore, Chennai, Hyderabad 01 Apr, 2025

Responsibilities and Duties Preparing documents related to dispatch such as invoices, shipping-labels, picklists etc Picking products from the warehouse for each batch Getting the products packed...
transportwarehouse managementlogistics managementwarehouse clerkpacking materialslogistics freight station warehousingwarehouse managersupply chainswarehouse logistics

NTT DATA Virtual Drive Hedge Fund Gurgaon
NTT DATA INFORMATION PROCESSING SERVICES PRIVATE LIMITED 1.00 to 3.00 Years Gurugram 01 Apr, 2025

NTT DATA is Hiring experienced candidates for Hedge Fund Accounting domain. Location:Gurgaon Sector 48 (Candor Techspace) Work from Office Only Shift ...
reconciliationhedge fundsnav calculationinvestment banking

Hospital Manager
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 13.00 to 18.00 Years Gurugram,Delhi, Bangalore, Kochi, Chennai, Hyderabad, Kolkata, Kollam, Thiruvanananthapuram, Mumbai 01 Apr, 2025

We are looking for an experienced Hospital Administration Manager to run our medical facility. To be successful in this role, you should have a deep understanding of all administrative hospital ...
problemmanagementbudgetingassurancecollaborationcommunicationqualityfinancialsolving

Design Verification Engineer
GLOBEX DIGITAL SOLUTIONS PRIVATE LIMITED 6.00 to 11.00 Years Kochi,Bangalore, Chennai, Noida, Hyderabad, Gurugram, Pune, Mumbai City, Delhi, Ahmedabad 01 Apr, 2025

Greeting form Globex Digital.! Please find the job description for _Design Verification Engineer interested please revert back with updated resume. JD: Design Verification Engineer Experience:...
uvmsystem verilogdesign verificationsub systems

Material Management Executive
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 10.00 to 19.00 Years Thiruvanananthapuram,Other Maharashtra, Bangalore, Chennai, Other Tamil Nadu, Hyderabad, Kolkata, Mu 01 Apr, 2025

Our growing business is searching for a qualified materials manager to oversee our inventory and purchasing operations. If you are an experienced and competent individual with in-depth knowledge ...
supply chain managementlogistics coordinationpurchase orderscontinuous improvementmaterial planning

Hospital Manager
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 13.00 to 18.00 Years Kochi,Kollam, Thiruvanananthapuram, Bangalore, Chennai, Hyderabad, Gurugram, Kolkata, Mumbai City, D 01 Apr, 2025

We are looking for an experienced Hospital Administration Manager to run our medical facility. To be successful in this role, you should have a deep understanding of all administrative hospital ...
problemmanagementbudgetingassurancecollaborationcommunicationqualityfinancialsolving

Procurement Assistant
SHARMA ENTERPRISES 1.00 to 6.00 Years Ernakulam,Kochi, Kozhikode, Malappuram, Thrissur, Gwalior, Indore, Bokaro, Ranchi, Bhopal 01 Apr, 2025

We are currently searching for a Procurement Assistant supports the purchasing and supply chain processes, assisting with tasks like sourcing suppliers, preparing purchase orders, maintaining pro...
purchase operationssupplier quality assurancesourcing materialsinventory managementrecord maintenancedata analysisrecord keeping

Audit Associate
Emrys Creatives 3.00 to 7.00 Years Kozhikode,Other Kerala 01 Apr, 2025

Company Description EMRYS Global LLC offers professional services in tax, accounts audit, legal consulting, and outsourcing. The company provides clever solutions for various financial problems u...
financial statement analysisfinancial auditsanalytical skills

E2E CNX Architect / CNX Solution Architect
Infosys Limited 4.00 to 8.00 Years Other Kerala,Thiruvananthapuram 01 Apr, 2025

Key Responsibilities: A day in the life of an Infoscion As part of the Infosys consulting team your primary role would be to lead the engagement effort of providing high quality and value adding...
AWSDevOpsGoogle Cloud PlatformKubernetesTelecomSDLCAgile MethodologiesProject ManagementTeam ManagementAgile CoachBusiness Analyst

Admin Executive
MUTHOOT HONDA 2.00 to 6.00 Years Other Kerala 01 Apr, 2025

Providing assistance to the HR team in recruitment and onboarding. Providing support in ABS-wide (asset-backed securities) projects. Managing calendar as well as associated operations. Other tas...
RecruitmentOnboardingCalendar ManagementTravel PlanningAdministrative SupportAssetbacked securitiesDocumentation PreparationMeeting Organization

Financial Controller
GF HOTELS AND RESORTS 10.00 to 14.00 Years Other Kerala 01 Apr, 2025

Responsibilities Maintaining internal controls over financial reporting Presenting financial reports to an executive team Overseeing the preparation of budgets Managing accounting records Eva...
Financial reportingBudget preparationRisk managementRegulatory complianceFinancial statementsFinancial reportsAccounting records managementFinancial data analysisAuditing processes coordination

Divisional Manager
TEAMWORK CABLES PRIVATE LIMITED 16.00 to 25.00 Years Kannur,Kasargod, Kottayam, Kozhikode, Malappuram, Thiruvanananthapuram, Bangalore, Chennai, Mangalor 01 Apr, 2025

The Division Manager plays a vital role in overseeing and managing the operations of an entire division within the company. This position requires a blend of strategic oversight, operational manag...
foreign assistanceindustrial policymanagerial economicstrade negotiationoperating agreementsindustrial economicstrade agreementsdivision ordersmanager

Finance Administration Analyst
ASSETCARE SERVICES PRIVATE LIMITED 1.00 to 5.00 Years Kottayam,Bangalore, Chennai, Ghaziabad, Hyderabad, Kolkata, Gurugram, Faridabad, Mangalore, Ahmedaba 01 Apr, 2025

Financial Management Analysts examine budget estimates for completeness, accuracy, and conformance with procedures and regulations. Analyze budgeting and accounting reports. Afinancial analyst tr...
analysissoftwareaccountingdataexcelcommunicationcollaborationmodelingspreadsheetfinancialmathematical

Immediate Vacancies for Electrical Engineer Fresher
Karnataka Information Solution 0.00 to 4.00 Years Kochi,Bangalore, Chennai, Hyderabad 01 Apr, 2025

Job Description Electrical Engineer Educational Qualification: BE / B.Tech in Electrical Job Types : Fresher, Experienced Salary : Rs.25,000/- to 50000/- Responsibilities: Designing, maintain...
electrical maintenancecontrol paneltransformersswitchgearautomation

Payroll Coordinator
M/S B NANDI 10.00 to 20.00 Years Delhi,China, Qatar, South Africa, Tambaram, Bhubaneswar, Bangalore, Jaipur, United Arab Emirates, Hy 01 Apr, 2025

We are looking for a payroll coordinator to manage all payroll activities and ensure the timely and accurate payment of employee wages. The payroll coordinator will ensure the collection of all n...
transfer pricing analysisbenefitsrecord keepingpromotionspayroll managementpaychex

PREV
NEXT

preparing financial projections Job Openings

About the internship Se... mba freshersmba hr

Pipeline Engineer Job Description Template We are looking for a highly experienced pipeline engineer to design and develop a variety of pipeline... budgetingblueprintcommunicationrepairconstruction technologytechnical standards

Pipeline Engineer Job Description Template We are looking for a highly experienced pipeline engineer to design and develop a variety of pipeline... budgetingblueprintcommunicationrepairconstruction technologytechnical standards

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

About the internship Se...
mba freshersmba hr

Pipeline Engineer Job Description Template We are looking for a highly experienced pipeline engineer to design and develop a variety of pipeline...
budgetingblueprintcommunicationrepairconstruction technologytechnical standards

Pipeline Engineer Job Description Template We are looking for a highly experienced pipeline engineer to design and develop a variety of pipeline...
budgetingblueprintcommunicationrepairconstruction technologytechnical standards