rfprfi responses jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

rfprfi responses Job Openings

Showing 51 - 100 of 1007 Jobs

International Customer Support Specialist

Live Connections Fresher Mohali 22 Nov, 2025

Position : Customer Support Specialist (International Voice/Non-Voice)

Location

bpo sales

inbound calls

customer relationship

non voice process

voice process

customer care

international process

customer support

customer service

Customer Support Executive-Blended

Provana India Private Limited Fresher Noida 19 Nov, 2025

About the Role:

international call center

international calling

international bpo

Team Lead- Field Sales

One97 Communications Limited Fresher Chandigarh, All India 19 Nov, 2025

Channel Sales

Distribution

Field Sales

Channel Partner Management

Presales Engineer

Fire Systems Pvt Ltd Fresher Ahmedabad, All India 19 Nov, 2025

Access Control systems

Integration skills

Presales experience

Sales experience

Knowledge of Security proto

Executive / Manager - Customer Success

iServeU Fresher Bhubaneswar, All India 13 Nov, 2025

Customer Relationship Management

Networking

Relationship Building

Product Strategy

Upselling

Customer Success

Sales Account Management

Market Trends Analysis

Revenue Growth

Renewals Management

SAP Presales Solution Architect

Best Infosystems Ltd Fresher Noida, DelhiDelhi, Bangalore, Chennai, Hyderabad, Gurugram, Pune, Mumbai City 12 Nov, 2025

sap

solution architecture

Process Analyst BPM

Provana India Private Limited Fresher Noida 12 Nov, 2025

Job Title

Location

Shift

About the Role: chat processinternational call centerinternational voice processvoice processblended process

SAP Presales Solution Architect
Best Infosystems Ltd Fresher Chennai, BangaloreBangalore, Noida, Hyderabad, Gurugram, Pune, Mumbai City, Delhi 12 Nov, 2025

SAP Presales Solution Architect_Bangkok, Thailand_Full-Time Hi, Greetings from Best Infosystems Ltd.! Weve spotted your impressive profile and have an exciting opportunity tailored to your skill...
sapsolution architecture

International Voice process Executive
Wroots Global Private Limited Fresher Bangalore 10 Nov, 2025

Job Title: International Voice Process Executive Salary: Upto 7 lpa We are looking for enthusiastic ...
international voice processvoice processinternational call centercustomer support

Email Support Executive
Square Business Services Pvt Ltd Fresher Hyderabad 07 Nov, 2025

Mega Walk-In Drive: Email Support Executives Wanted!
Join Indias Leading ...
communication skillsemail support

Customer Support Backend Process
PORTRAY PEOPLE PRIVATE LIMITED Fresher Noida 07 Nov, 2025

We are looking for a dedicated and customer-focused Customer Support Executive to join in Noida. The ideal candidate will have prior experience in c...
email supportchat process

Assistant Manager- Finance & Accounts
Cadila Pharmaceuticals Ltd Fresher Gujarat 05 Nov, 2025

JOB RESPONSIBILITIES- 1. Accounting & Financial Reporting Ensure accurate and timely recording of financial transactions in Tally Prime. Prepare financial statements. Perform bank reconciliati...
treasury managementfinancetax compliance

SAP Presales Solution Architect
Best Infosystems Ltd Fresher Pune, BangaloreBangalore, Noida, Chennai, Hyderabad, Gurugram, Mumbai City, Delhi 03 Nov, 2025

SAP Presales Solution Architect_Bangkok, Thailand_Full-Time Hi, Greetings from Best Infosystems Ltd.! Weve spotted your impressive profile and have an exciting opportunity tailored to your skill...
sapsolution architecture

RPA UIPath Developer
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Pune, ChennaiChennai, Noida 03 Nov, 2025

Connect me over my mail - hidden_email or whatsapp me onhidden_mobile This role will be responsible for design, build, test and support au...
uipathstudioorchestrator

Customer Support Representative
Hucon Solutions India PvtLtd Fresher Hyderabad 03 Nov, 2025

GREETING FROM HUCON SOLUTIONS Hiring for MNCs Process: International Voice Process Job Details:International Voice Process Location:Hyderabad Eligibility Criteria freshers to 5 years of exp...
semi voice processvoice supportchat process

RPA UIPath Developer
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Noida, ChennaiChennai, Pune 03 Nov, 2025

Connect me over my mail - hidden_email or whatsapp me onhidden_mobile This role will be responsible for design, build, test and support au...
uipathstudioorchestrator

RPA UIPath Developer
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Chennai, NoidaNoida, Pune 03 Nov, 2025

Connect me over my mail - hidden_email or whatsapp me onhidden_mobile This role will be responsible for design, build, test and support au...
uipathstudioorchestrator

Email Support (Non-Voice)
Hirexcel Corporation Fresher Thane 30 Oct, 2025

Process:Email Support (Non-Voice) Location:Thane West Eligibility:

Minimum HSC (12th Pass)

Minimum 1 year experience in E...
email supportchat processemail clientscustomer supportnon voice processemail process

Customer Service Executive
Confidential Fresher Delhi 30 Oct, 2025

Dear Candidates,
We have an urgent hiring for the below role: ...
ccecustomer supportbpocustomer servicecustomer carecall centre voiceprocessvoice

Credit Risk Business Analyst
People Prime Worldwide Fresher Pune, Maharashtra 28 Oct, 2025

You will be responsible for validating and monitoring models related to credit risk, market risk, counterparty credit risk, fraud detection, stress testing, AML, and forecasting. Your key responsi...
Model ValidationCredit RiskMarket RiskFraud DetectionStress TestingAMLPythonSASSQLCounterparty Credit Risk

Customer Solutions Manager
Maersk Fresher Haryana 28 Oct, 2025

In this role at Maersk as a Solutions Manager, you will play a key role in driving growth in Logistics & Services (L&S) by utilizing top-tier consultative selling techniques and customer solutions...
Supply Chain ManagementEXIMSolution DesignProject ManagementStakeholder ManagementConsultative SellingValue CreationInternational Supply ChainSales ProcessesLogistics Technology

People Consulting - HRT - Manager
EY Fresher Noida, Uttar Pradesh 28 Oct, 2025

As a Manager in the People Consulting (PC) team at EY, you will play a crucial role in managing the global workforce in todays fast-changing environment. Your key responsibilities will include: -...
HR TransformationWorkdaySuccessfactorsHR AnalyticsChange ManagementProject ManagementBusiness Case DevelopmentHR Tech implementationProcess ReengineeringOperating Model RedesignHR SSC implementationHR Cloud SystemsHR Operating Model DesignOrg

Customer Support Executive Noida (On-site)
PORTRAY PEOPLE PRIVATE LIMITED Fresher Noida 28 Oct, 2025

About the Role
We are looking for a dedicated and customer-focused Cust...
chat processemail process

Business Analyst - Logistics, Shipping & SCM
Intech - Client of Clastech Solutions & Services Pvt Ltd Fresher Ahmedabad, Gujarat 26 Oct, 2025

As a Business Analyst in the Shipping, Logistics & SCM domain, your role will involve inventing processes or systems needed to implement changes. You must possess strong communication and interper...
workshopsanalytical skillsagile environmentreengineeringJIRAConfluenceVisioExcelMS Projectinterpersonal skillscommunication skillsShippingLogisticsrequirements managementproblem solvingplanning skillsQuality AssuranceCustomer relations

Senior Executive, Regulatory Affairs, Pre Approval Injectable USA Market
Amneal Pharmaceuticals Fresher Ahmedabad, Gujarat 26 Oct, 2025

Role Overview: As a Regulatory Affairs Specialist at Amneal, your primary responsibility will be to prepare regulatory strategies for complex products such as injectables, ophthalmic, otic, topica...
InjectablesPeptidesMicrospheresLiposomesAPIRegulatory strategiesComplex ProductsNanosuspensionsOphthalmicOticTopical gelDDCP505b2 ProductsPreANDAPreINDScA meeting packagesDrafting controlled correspondencesDeficiency responsesFP invitro

Associate Systems Engineer(SQL, Windows Server)
Altera Digital Health India Fresher Vadodara, Gujarat 19 Oct, 2025

Altera, a member of the N. Harris Computer Corporation family, delivers health IT solutions that support caregivers around the world. These include the Sunrise, Paragon, Altera TouchWorks, Altera ...
AppDynamicsWindows Server administrationroot cause analysistroubleshootinganalytical skillscommunication skillsLogicMonitorAzure MonitorSQL databasesIIS management

Pre Sales Business Analyst
Prioxis Technologies (Formerly HypeTeq Software) Fresher Ahmedabad, Gujarat 19 Oct, 2025

As a Pre Sales Business Analyst at Prioxis Technologies in Ahmedabad, you will play a crucial role in analyzing business requirements, communicating with clients, performing business analytics, an...
Business AnalysisRequirements GatheringUser StoriesUse CasesGap AnalysisFeasibility StudiesWireframesStakeholder ManagementRFPRFI ResponsesSolution Presentations

Hiring Fr BPOs//Call Centers fr Customer support//Technical Specialist!
IZEE MANPOWER CONSULTANCY PVT LTD Fresher Pune, BangaloreBangalore, Hyderabad 14 Oct, 2025

Job description Hiring For HIGH END INTERNATIONALCallCentres//BPOs fr Customer Support Specialist and Also fr Technical Support Specialist Role!! Call @ customer servicecustomer supportcsr

International Voice process Executive
Wroots Global Private Limited Fresher Bangalore 08 Oct, 2025

Job Title: International Voice Process Executive Salary: Upto 7 lpa We are looking for enthusiastic ...
international voice processvoice processinternational call centercustomer support

Senior Specialist - Data Sciences
LTIMindtree Limited Fresher Hyderabad 08 Oct, 2025

Job Title: GenAI Technical Support Advisory Lead L25 Support Layer Location: India Remote or India Office Work Hours: US Time Zone Active until 300 PM PST Role Overview We are looking for a h...
AI Engineering

RPA UIPath Developer
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Pune, ChennaiChennai, Noida 01 Oct, 2025

Connect me over my mail - hidden_email or whatsapp me onhidden_mobile This role will be responsible for design, build, test and support au...
uipathstudioorchestrator

Presales Consultant
Hinduja Global Solutions Limited (HGS) Fresher Mumbai City 01 Oct, 2025

Job Description Associate/Senior Associate - Presales The Pre-sales, in an individual contributor role, will be responsible to support the sales team and other stakeholders at HGS (Business Ser...
sowrfqpresalesrfp

RPA UIPath Developer
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Noida, ChennaiChennai, Pune 01 Oct, 2025

Connect me over my mail - hidden_email or whatsapp me onhidden_mobile This role will be responsible for design, build, test and support au...
uipathstudioorchestrator

RPA UIPath Developer
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Chennai, NoidaNoida, Pune 01 Oct, 2025

Connect me over my mail - hidden_email or whatsapp me onhidden_mobile This role will be responsible for design, build, test and support au...
uipathstudioorchestrator

Medical oncologist DM DNB consultant
Medico Hub Fresher Ahmedabad, Gujarat 28 Sep, 2025

As a Medical Oncologist DM DNB Consultant, you will play a crucial role in the diagnosis, treatment, and management of patients with cancer. Your expertise and decision-making will directly impact...
OncologyClinical ResearchCommunicationInterpersonal SkillsClinical SoftwareLeadershipElectronic Medical RecordsMentorshipRegulatory Standards

presales consultant
BSH TECHNOLOGIES PRIVATE LIMITED Fresher Bhubaneswar 24 Sep, 2025

Work closely with the Business Development & Sales teams to support lead qualification and opportunity conversion.

Conduct r...
crmpresentationsclientsmbsoftwaresalestoolsexcelpowerpointdemosmarketproposalsstrongmandatory.knowledgesystems.serviceslikeestimationsusing

Sales Coordinator
PRABHA ENGINEERING PVT LTD Fresher Mumbai City 23 Sep, 2025

Position Overview We are seeking a dynamic and detail-oriented Sales Coordinator to join our team in Mumbai City. This full-time position offers an exciting ...
manufacturing engineeringsales coordinationbusiness developmentmarketing

ERP Executive
ENLIVEN DIGITAL CONTENT Fresher Rajkot, Gujarat 20 Sep, 2025

You are a proactive and customer-focused ERP Support Executive who will be responsible for providing functional support to ERP users, resolving queries, coordinating with internal teams, and ensur...
Functional supportTroubleshootingCoordinationDocumentationTrainingMonitoringTestingData entrySQLERP support

Executive Assistant to CEO
Talent Scouters Fresher Vadodara, Gujarat 11 Sep, 2025

As an Executive Assistant, you will provide administrative support to the CEO, encompassing a wide range of responsibilities beyond secretarial duties. Your key tasks will include gathering, verif...
Administrative SupportData AnalysisReport PreparationDocument PreparationTravel ArrangementsCompliance ManagementResearchVisitor ManagementMeeting Coordination

Email Support Executive
Square Business Services Pvt Ltd Fresher Raipur 11 Sep, 2025

Join our team as a Non-Voice Support Trainee where the ideal candidate will manage email communications in ensuring our customers receive prompt and high-quality assistance. Yo...
communication skillsenglish typing

Sales Executive/Customer Service
Golden Freight Forwarding & Marketing Pvt Ltd Fresher Ludhiana, Punjab 11 Sep, 2025

As a skilled professional in freight forwarding sales and customer service, you will be responsible for developing and managing business opportunities within the Canada import/export market. Your ...
customer serviceinternational logisticscustomscommunication skillsMicrosoft Officefreight forwarding salesIncoterms

Associate II - Client Onboarding, Kyc, Excellent Communication
UST Fresher Kochi, Kerala 11 Sep, 2025

A Voice Associate should be able to effectively and efficiently handle customer support calls following the SOPs to resolve issues or escalate as required in alignment with SLAs. A Data Associate ...
OnboardingKYC

Sustainability Tax Senior
EY Fresher Kerala 09 Sep, 2025

At EY, youll have the chance to build a career as unique as you are, with the global scale, support, inclusive culture, and technology to become the best version of you. And were counting on your ...
Project ManagementAnalytical SkillsInterpersonal SkillsCommunication SkillsMicrosoft OfficeIndirect TaxVATPower BIAlteryxTax Applications

Pre Sales Consultant
ETHOS HR MANAGEMENT AND PROJECTS PVT LTD Hiring For Techronous Fresher Ahmedabad 09 Sep, 2025

Conduct in-depth requirement gathering sessions with prospects and clients

Deliver compelling, customized D365 product demonstrations (CE, CRM, Sales, or Finance modules).
...
pre salescrm salessolution consultant

Executive / Manager - Customer Success
iServeU Fresher Bhubaneswar 03 Sep, 2025

As a member of the iServeU team, you will play a crucial role in expanding our customer base within the assigned category of merchant customers. Your responsibilities will include identifying and ...
Customer Relationship ManagementNetworkingRelationship BuildingProduct AdoptionUpsellingCustomer SuccessSales Account ManagementMarket Trends AnalysisRevenue GrowthRenewals Management

Area Sales Officer
Arbour Clothing co Fresher Vijayawada, Andhra Pradesh 29 Aug, 2025

As a Field Sales Representative, you will play a crucial role in enhancing our sales performance. Your primary responsibility will involve identifying new sales opportunities, closing deals effect...
SalesNegotiationLead GenerationClient ManagementCommunicationInterpersonal Skills

Junior Service Desk Technician
DYOPATH Fresher Ahmedabad, Gujarat 29 Aug, 2025

Are you passionate about solving technical problems and helping people stay connected If you thrive in a fast-paced environment and enjoy being the go-to person for IT support, we want to hear fr...
Communication skillsSystem imagingActive DirectoryProblemsolvingDesktoplaptop support

Customer Support Representative
SPARKHIVE Fresher Pune, Mumbai CityMumbai City, Delhi 22 Aug, 2025

This is a contract remote role for a Resolution Expert at TP. The Resolution Expert will be responsible for resolving customer queries and issues, providing efficient and effective solutions, and...
customer supportvoice support

Operations Executive
VISHAN BUSINESS CONSULTANCY Fresher Kolkata 22 Aug, 2025

Job Summary We are seeking a proactive Operations Associate to support the functioning of our operations team for daily/periodic activities. Key Resp...
sebi regulationscommunication skillsmicrosoft wordsebi compliancefinancial markets

Chief Engineer
Park Inn By Radisson Jabalpur - Preopening Fresher Jabalpur, Madhya Pradesh 22 Aug, 2025

As a Chief Engineer at Radisson Hotel Group, you will play a crucial role in ensuring the smooth running of the property maintenance department to maintain all areas at the highest levels. By proa...
Leadership SkillsCommunication SkillsProperty MaintenanceProblemsolvingHospitality Industry Knowledge

PREV
NEXT

rfprfi responses Job Openings

Mega Walk-In Drive: Email Support Executives Wanted!

Dear Candidates,

About the Role

Position Overview We are seeking a dynamic and detail-oriented Sales Coordinator to join our team in Mumbai City. This full-time position offers an exciting ... manufacturing engineeringsales coordinationbusiness developmentmarketing

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Position Overview We are seeking a dynamic and detail-oriented Sales Coordinator to join our team in Mumbai City. This full-time position offers an exciting ...
manufacturing engineeringsales coordinationbusiness developmentmarketing