safety technician jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

safety technician Job Openings

Showing 21751 - 21800 of 22507 Jobs

Technical Support Engineer

NATIONAL SEEDS CORPORATION LIMITED 3.00 to 8.00 Years Pune 23 Sep, 2023

technical engineering

maintenance engineering

engineering management

criticality analysis

technical helpdesk

Civil Site Eng,Safety Officer Mechanical Production Electrical Engineer

D Y EARTH MOVERS 0.00 to 4.00 Years Pune 23 Sep, 2023

design engineering

civil engineers

electrical site engineering

site engineering

production engineering

civil maintenance

quality engineering

electrical maintenance engineer

mechanical maintenance engineer

Dy Manager - Hydraulics Machining

Mahindra business & consulting services p ltd 3.00 to 6.00 Years Nagpur 23 Sep, 2023

Responsibilities & Key Deliverables

effective communication

Operations Analyst (Pre- Post Sales) - Gurugram

ValueDrive Technologies Pvt Ltd 1.00 to 6.00 Years Gurugram 23 Sep, 2023

About the role:

This is in office job to provide excellent customer service from intake to
release of their vehicles.
Determine and diagnose car is...
automobile serviceautomobile engineeringautomotiveautomotive sales

Retail Sales Manager

TALENTSTACK CONSULTING PRIVATE LIMITED 10.00 to 20.00 Years Noida 23 Sep, 2023

Designation / Position Retail Sales Manager
Job Description (Minimum 250 characters)* Organize all store operations and allocate responsibilities to pe...
network managementretail sales

Team Assemblers

Krishna Consultancy Hiring For Schneider Electric 10.00 to 20.00 Years Noida 23 Sep, 2023

organization

dexterity

physical fitness

resource conservation

detail orientation

STORE MANAGER MYSORE

Growth Manpower 0.00 to 1.00 Years Mysore 23 Sep, 2023

store managementstore keepingperformance measurement

Hire Production Engineer In Mysore

Rise Placement 0.00 to 3.00 Years Mysore 23 Sep, 2023

production engineeringproductionproduction engineer

Store manager Mysore

KABIR CONSULTANCY Hiring For - 0.00 to 1.00 Years Mysore 23 Sep, 2023

delivery managementstore operationsstore keepingstore supervisionstore management

Electrical Engineer-Mysore

JS Placement Services 0.00 to 3.00 Years Mysore 23 Sep, 2023

electrical engineeringtroubleshooting

Urgent hiring for CIVIL SITE ENGINEER in Dubai

Always International Manpower Service Hiring For Civil /Site engg/Mechanical /Electrical Engineer Supervisor 1.00 to 6.00 Years Mangalore 23 Sep, 2023

Civil Site Engineer Civil Foreman / Mechanical Engineer / Electrical Engineer Job in Dubai

Salary : 1800 to 5500 AED . ( INR 35000 to 1 lakh- PM) Facilities : Accommodation ...
mechanical designmechanical engineeringpower distributionelectrical engineeringcivil constructionmechanical electrical plumbingcivil site engineeringcivil infrastructure

Hiring For Civil Engineer
Kavya Staffing Solutions 0.00 to 4.00 Years Mangalore 23 Sep, 2023

We are looking for an experienced, driven civil engineer with a wealth of industry knowledge. To ensure success, the ideal candidate should be comfortable splitting their hours between the office...
managementplanningconstructionautocadproject

Looking for CDP Asian - Authentic Asian Background
Hyatt 1.00 to 4.00 Years Hyderabad 23 Sep, 2023

You will be responsible to assist with the efficient running of the department in line with Hyatt Internationals Corporate Strategies and brand standards, whilst meeting employee, guest and owner...
microsoft outlookpowerpointmicrosoft excelmicrosoft word

Hire Engineer-Faridabad
JS Placement Services 0.00 to 3.00 Years Faridabad 23 Sep, 2023

designtroubleshooting

Hire Engineer-Noida
JS Placement Services 0.00 to 3.00 Years Noida 23 Sep, 2023

designtroubleshooting

Electrical Engineer-Faridabad
JS Placement Services 0.00 to 3.00 Years Faridabad 23 Sep, 2023

electrical engineeringelectrical systems

Electrical Engineer-Noida
JS Placement Services 0.00 to 3.00 Years Noida 23 Sep, 2023

electrical engineeringtroubleshooting

Manufacturing Quality Line In-charge Battery Testing
Hero MotoCorp Ltd 5.00 to 7.00 Years Delhi 23 Sep, 2023

Function Quality Pay Band E4 to M2 Role As the Manufacturing Quality Line In-charge Battery Testing you ...
sporting goods industrycontinuous improvement facilitationfield hockeylatin americamass productionapplicationscritical thinkingelectric vehiclesdurability testingquality improvementmanufacturing qualityimprovement activitieseffective communica

Multi Technician UAE 9th Sep.
GLOBAL WINGZ CAREERS Hiring For Multi Technician_UAE 9th Sep 4.00 to 7.00 Years Chennai 23 Sep, 2023

Dear Applicants, Greetings from Global Wingz Careers LLP!! We are looking for applicants willing to work for UAE Mode of Interview:Direct Client Interview Da...
plumbingelectricalsmulti technician

apply now Vehicle Computer- Functional Safety Engineer
Bosch Group 3.00 to 5.00 Years Bangalore 22 Sep, 2023

Job Description Mandatory skills:

Very Good understanding of ISO 26262 safety dev process

Hand-on experience of working on Microprocessor domain

Good ...
safetyfirst aidinspectionsiterisk assessmentsoftware engineeringprogramming languagestechnical documentationautomotive locksmithingagile scrum

Store Manager
NATIONAL SEEDS CORPORATION LIMITED 5.00 to 10.00 Years Bangalore 22 Sep, 2023

We are looking for a professional and customer service-oriented store manager to oversee daily operations at our store. As the store manager, you will supervise the operational and organizational...
business strategiesstore keepingsupervisionhr operationsmonitoringstores maintenancesafety trainingsales support

Pharmacovigilance Officer
QUISCON BIOTECH 0.00 to 1.00 Years Bangalore 22 Sep, 2023

Pharmacovigilance Associate- Freshers Typical responsibilities include: recording and reporting adverse reactions received from healthcare professionals and consumers conducting in-depth interv...
clinical research associatesclinical pharmacologyclinical trialsclinical monitoringclinical data management

Team Assemblers
Krishna Consultancy Hiring For Schneider Electric 10.00 to 20.00 Years Bangalore 22 Sep, 2023

Assemblers are a vital part of the manufacturing process and can be found in almost any field. Their job titles may vary according to the industry, but some commonly used titles for assemblers ar...
organizationdexterityphysical fitnessresource conservationdetail orientation

We Have Reuire Application Developer
Accenture 1.00 to 6.00 Years Bangalore 22 Sep, 2023

About Accenture: Accenture is a global professional services company with leading capabilities in digital, cloud and security. Combining unmatched experience and specialized skill...
kaizenlean manufacturingsafetyinspectionmachiningms sql serverms sqlvisual studiobusiness processsystem installationsoftware engineeringsystem administrationprofessional servicessqlapi

Process Engineer
AVHAD ENTERPRISES 5.00 to 10.00 Years Vishakhapatnam 14 Sep, 2023

We are looking to hire a skilled process engineer to oversee the design and implementation of our company processes. As a process engineer, you will be responsible for developing and implementing...
designproject engineeringprocessoilfront end engineering designconstructionengineering change controlengineering consultancyengineering change managementgasengineering servicesmechanical engineeringengineering

We Need EHS Executive
Foursis Technical Solution 5.00 to 7.00 Years Vadodara 14 Sep, 2023

Job functions area : Safety / Fire / Guards / Security Location : Vadodara Experience : 5 - 7 years Skills : AUDIT, HAN...
safetyrisk assessmentehsinspection

Head Engineering - Vadodara
Foursis Technical Solution 8.00 to 11.00 Years Vadodara 14 Sep, 2023

Job functions area : Engineering / Manufacturing / Production / Maintenance Location : Vadodara Experience : 8 - 11 years Skills ...
mechanicalmachinerycivilsafetysapquality checkmonitoringmaintenanceengineeringdocumentationKaizenRoot Cause AnalysisSix Sigma

Required now for Lab Technician -Vadodara
Foursis Technical Solution 2.00 to 3.00 Years Vadodara 14 Sep, 2023

Job functions area : Pharma / Biotechnology / Healthcare Location : Vadodara Experience : 2 - 3 years Skills : LAB EXPE...
biochemistrymicrobiologyquality controlhematologypathologydmltpharmatestingchemistrybiotechnology

Aircraft Maintenance Engineer Recruitment
Kavya Staffing Solutions 0.00 to 4.00 Years Vadodara 14 Sep, 2023

We are looking for an experienced Aircraft Maintenance Engineer to join our team and ensure the safety of our aircraft. The aircraft maintenance engineers responsibilities include conducting insp...
technician activitiesaeronauticalaerospace designaircraft

Carpenter Foreman
AWINMO INDIA MARKETING PRIVATE LIMITED 8.00 to 13.00 Years Pune 14 Sep, 2023

Carpenter Job Description Template We are looking to hire a skilled carpenter with knowledge of various carpentry techniques. You will be responsible f...
mechanicalskills.dexterity.mathproblem-solving.strength.physical

Farm Manager
RAMA TECHNICAL CONSULTANTS 11.00 to 21.00 Years Pune 14 Sep, 2023

We are searching for a manager with good business sense to join our team. The farm managers responsibilities include monitoring staff, crops, and livestock, purchasing supplies, preparing budgets...
farm managementfarmingfarm equipmentagricultural machinery

Farm Supervisor
RAMA TECHNICAL CONSULTANTS 10.00 to 20.00 Years Pune 14 Sep, 2023

We are searching for a manager with good business sense to join our team. The farm managers responsibilities include monitoring staff, crops, and livestock, purchasing supplies, preparing budgets...
agriculture bankingfarmingagriculture marketingplant protection

Construction Manager
RAMA TECHNICAL CONSULTANTS 10.00 to 20.00 Years Pune 14 Sep, 2023

We are looking for an enthusiastic, organized construction manager to oversee all aspects of our building project, including meeting with project partners, managing supervisors, and teams. The co...
contract managementcontract manufacturingconstruction management

Guest Services Manager
Garima Interprises Hiring For Garima Interprises 5.00 to 7.00 Years Pune 14 Sep, 2023

As a guest service manager, you will ensure a smooth check-in and check-out process and ensure that all payments are made. You will manage all lobby activities and see to the functionality of hot...
teamworkcommunication skillsinterpersonal skillsteam management skills

Store manager Nagpur
KABIR CONSULTANCY Hiring For - 0.00 to 1.00 Years Nagpur 14 Sep, 2023

Store Manager Responsibilities:
store keepingstore managementstores maintenancestore supervisiondelivery management

Farm Supervisor
RAMA TECHNICAL CONSULTANTS 10.00 to 20.00 Years Noida 14 Sep, 2023

We are searching for a manager with good business sense to join our team. The farm managers responsibilities include monitoring staff, crops, and livestock, purchasing supplies, preparing budgets...
agriculture bankingfarmingagriculture marketingplant protection

Quality Engineer
Manpower Solution Fresher Noida 14 Sep, 2023

Quality Engineer Job Description Template We are looking for a quality engineer to monitor and improve the quality of our...
quality managementquality assurance engineeringquality assurancequality engineeringquality controlquality audit

Food Truck Manager
Garima Interprises Hiring For Garima Interprises 5.00 to 9.00 Years Noida 14 Sep, 2023

Plan, schedule, manage, lead and direct Restaurant / Food Truck operations. Achieve Restaurant / Food Truck budget targets on a monthly, quarterly and annual basis. Create an environment of outst...
communication skillsenergygreat attitudeenthusiasm

Guest Services Manager
Garima Interprises Hiring For Garima Interprises 5.00 to 7.00 Years Noida 14 Sep, 2023

As a guest service manager, you will ensure a smooth check-in and check-out process and ensure that all payments are made. You will manage all lobby activities and see to the functionality of hot...
teamworkcommunication skillsinterpersonal skillsteam management skills

Food Truck Manager
Garima Interprises Hiring For Garima Interprises 5.00 to 9.00 Years Mumbai City 14 Sep, 2023

Plan, schedule, manage, lead and direct Restaurant / Food Truck operations. Achieve Restaurant / Food Truck budget targets on a monthly, quarterly and annual basis. Create an environment of outst...
communication skillsenergygreat attitudeenthusiasm

Food Service Director
Garima Interprises Hiring For Garima Interprises 5.00 to 8.00 Years Mumbai City 14 Sep, 2023

A food service director is responsible for managing the foodservice operations, achieving the customers highest satisfaction by supervising the kitchen personnel, monitoring the food distribution...
culinarycommunication skillsservsafefood preparationcustomer servicecost control

Service Desk Technician II Navi Mumbai
DC Consultants 1.00 to 4.00 Years Navi Mumbai 14 Sep, 2023

Service Desk Technician II
Job description

Works with internal and external customers to log, categorize and prioritize incoming Incidents or Service Requests rec...
incident managementtroubleshooting skillsservice desk technicianservice desk procedures

Farm Manager
RAMA TECHNICAL CONSULTANTS 11.00 to 21.00 Years Hyderabad 14 Sep, 2023

We are searching for a manager with good business sense to join our team. The farm managers responsibilities include monitoring staff, crops, and livestock, purchasing supplies, preparing budgets...
farm managementfarmingfarm equipmentagricultural machinery

Farm Supervisor
RAMA TECHNICAL CONSULTANTS 10.00 to 20.00 Years Hyderabad 14 Sep, 2023

We are searching for a manager with good business sense to join our team. The farm managers responsibilities include monitoring staff, crops, and livestock, purchasing supplies, preparing budgets...
agriculture bankingfarmingagriculture marketingplant protection

Construction Manager
RAMA TECHNICAL CONSULTANTS 10.00 to 20.00 Years Hyderabad 14 Sep, 2023

We are looking for an enthusiastic, organized construction manager to oversee all aspects of our building project, including meeting with project partners, managing supervisors, and teams. The co...
contract managementcontract manufacturingconstruction management

Lead HR for a telecom co. at Hyderabad
Talent Leads HR Solutions Pvt Ltd 4.00 to 9.00 Years Hyderabad 14 Sep, 2023

We are looking for an -HR to lead Hr Function post onboarding right from induction to Exit formalities. You will take ownership of all HR matters across the company from Employee life cycle ma...
handlingoperationsexit processmanagementengagementemployee life cycleemployeeoperationemployee life cycle management

Senior Engineer - AMS Verification
Cyient Limited 6.00 to 10.00 Years Hyderabad 14 Sep, 2023

Cyient is a global engineering and technology solutions company. As a Design, Build, and Maintain partner for leading organizations worldwide, we take solution ownership across the value chain t...
commissioningsiteinspectiontroubleshootingsafety

Store manager Hyderabad
KABIR CONSULTANCY Hiring For - 0.00 to 1.00 Years Hyderabad 14 Sep, 2023

Store Manager Responsibilities:
delivery managementstores maintenancestore managementstore operationsstore keeping

Food Truck Manager
Garima Interprises Hiring For Garima Interprises 5.00 to 9.00 Years Hyderabad 14 Sep, 2023

Plan, schedule, manage, lead and direct Restaurant / Food Truck operations. Achieve Restaurant / Food Truck budget targets on a monthly, quarterly and annual basis. Create an environment of outst...
communication skillsenergygreat attitudeenthusiasm

Food Service Director
Garima Interprises Hiring For Garima Interprises 5.00 to 8.00 Years Hyderabad 14 Sep, 2023

A food service director is responsible for managing the foodservice operations, achieving the customers highest satisfaction by supervising the kitchen personnel, monitoring the food distribution...
culinarycommunication skillsservsafefood preparationcustomer servicecost control

PREV
NEXT

safety technician Job Openings

Civil Site Engineer Civil Foreman / Mechanical Engineer / Electrical Engineer Job in Dubai

Salary : 1800 to 5500 AED . ( INR 35000 to 1 lakh- PM) Facilities : Accommodation ... mechanical designmechanical engineeringpower distributionelectrical engineeringcivil constructionmechanical electrical plumbingcivil site engineeringcivil infrastructure

Carpenter Job Description Template We are looking to hire a skilled carpenter with knowledge of various carpentry techniques. You will be responsible f... mechanicalskills.dexterity.mathproblem-solving.strength.physical

Quality Engineer Job Description Template We are looking for a quality engineer to monitor and improve the quality of our... quality managementquality assurance engineeringquality assurancequality engineeringquality controlquality audit

Job description Works with internal and external customers to log, categorize and prioritize incoming Incidents or Service Requests rec... incident managementtroubleshooting skillsservice desk technicianservice desk procedures

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Salary : 1800 to 5500 AED . ( INR 35000 to 1 lakh- PM) Facilities : Accommodation ...
mechanical designmechanical engineeringpower distributionelectrical engineeringcivil constructionmechanical electrical plumbingcivil site engineeringcivil infrastructure

Carpenter Job Description Template We are looking to hire a skilled carpenter with knowledge of various carpentry techniques. You will be responsible f...
mechanicalskills.dexterity.mathproblem-solving.strength.physical

Quality Engineer Job Description Template We are looking for a quality engineer to monitor and improve the quality of our...
quality managementquality assurance engineeringquality assurancequality engineeringquality controlquality audit

Job description

Works with internal and external customers to log, categorize and prioritize incoming Incidents or Service Requests rec...
incident managementtroubleshooting skillsservice desk technicianservice desk procedures