site accounting jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

site accounting Job Openings

Showing 21951 - 22000 of 23316 Jobs

Junior Accountant

ELITERECRUITMENTS Hiring For Banking 0.00 to 3.00 Years Kochi 12 Oct, 2023

EliteRecruitments

Hiring For Banking

Junior Accountant Job Description

he candidate youll end up hiringshould have...
branch managementaccountingtaxation

Oil & gas industry Required for Rigger & Roustabout for offshore platform
APEX OFFSHORE SERVICE 0.00 to 1.00 Years Kakinada 12 Oct, 2023

Greeting We are hiring for the position of RIGGER/ROUSTABOUT with a leading Oil & Gas Industry Job Responsibility: -Chain and sling...
offshore platformsgasindustrystcwoilrigsrigersriggrsroustaboutes

Company secretary
OK LIFECARE PRIVATE LIMITED 1.00 to 5.00 Years Kakinada 12 Oct, 2023

Company secretaries advise company directors about how their organisations should be directed, managed and controlled. This is also known as corporate governance and it includes ensuring that the...
reportingriskcorporatecompliancemanagementlegalcommunicationsupportgovernanceanalysisaccountingresearchfinancialknowledge

Civil Engineer
AppSoft Solutions 0.00 to 4.00 Years Hyderabad 12 Oct, 2023

Looking For Civil Engineer Commercial architectural firm requires an experienced, highly technical Civil Engineer to join our team of design professionals. Were a progressive, tight-knit company...
cadcamautocadcad operator.cad engineerconstruction engineersite supervisordiploma civilproject engineer

Senior Construction Manager
AWINMO INDIA MARKETING PRIVATE LIMITED 9.00 to 14.00 Years Hyderabad 12 Oct, 2023

Construction Manager Job Description Template We are looking for an enthusiastic, organized construction manager to oversee all aspects of ou...
decision-making skills.communication skills.leadership skills.business skills.technical skills.

Manager, Construction Management, Self Perform
AWINMO INDIA MARKETING PRIVATE LIMITED 9.00 to 14.00 Years Hyderabad 12 Oct, 2023

Construction Manager [Intro Paragraph] The best job descriptions take two or three sentences to introduce prospective construction managers to ...
delegation.industry knowledge.team management.risk management.communication.negotiation.flexibility.

Accountant ( Infrastructure )
PRO APEX INFRA LLP 3.00 to 6.00 Years Hyderabad 12 Oct, 2023

Role: Accountant ( Infrastructure ) Experience needed: 3 - 6 years Department: Infrastructure Constructions & Site Engineering Educat...
ms officegstconstructiontallybook keepingaccounting

Project Specialist -SLP, Physical Security Program
Amazon 0.00 to 4.00 Years Hyderabad 12 Oct, 2023

- Management of Equipment lifecycle - AMCs, Repairs & Maintenance. - Manage Trainings for Internal & External partners. - Coordinate site launch activities and manage system integrators install...
presalesnetworkingoracle 10plsqlsqlaccess controlchange managementproject executionservice managementsystem integratorsbehavioral traininginformation technologysappmoamcscivil

Practitioner Finance and Administration Delivery
IBM India Pvt Limited 0.00 to 4.00 Years Hyderabad 12 Oct, 2023

Introduction The Finance & Admin Business Analyst is essential to the ongoing profitable operations for one of the most globally recognized and respected companies in the world. By overseeing our ...
time managementfixed assetsservice leveldesign thinking

Oracle EBS finance functional
LTIMindtree Limited 6.00 to 11.00 Years Hyderabad 12 Oct, 2023

LTIMindtree is hiring Oracle EBS Finance functional Role. Total exp : 5 to 12 Location: All LTI Offices (PAN india) Notice Period: Im...
accounts receivablegeneral ledgeroracle ebsaccounts payablefinance functionalebs financeebtax

SLP Coordinator, SLP Cluster - West 5
Amazon 3.00 to 5.00 Years Gurugram 12 Oct, 2023

The primary objective of the Security & Loss Prevention coordinator is to ensure the protection of people & assets of Amazon s FC in accordance with global Security guidelines and Policies The rol...
control roomnew projectsprocess reviewloss preventionlaw enforcementasset protectioncorrective actionprocess improvementbehavioral traininginformation securitypreventive maintenancesecurity investigationsamccareslascapa

Asst Manager - Private Equity Fund Accountin
NTT Global Delivery Services Limited 0.00 to 4.00 Years Gurugram 12 Oct, 2023

Roles and Responsibilities

Review Booking Journal Entries basis bank statements and client

Review of Bank Reconciliation and maintaining the respectiv...
cash flowhedge fundsprivate equityjournal entriesbank statementsfinancial reportingbank reconciliationfinancial justificationcashcapitalbespokeexpensesreportingportfoliomanagementmonitoringmaintenanceperformanceliabilities

Vendor Management New Associate-Procurement management
Accenture 0.00 to 1.00 Years Gurugram 12 Oct, 2023

Skill required: Procurement management - Vendor Management Designation: Vendor Management New Associate Job Location: G...
accounts payableaccounts payablereceivableapproval processbudgetingcreditroot causeissue resolutionvendor managementthought leadershipclient relationshipsupplier enablementcommunication skillsprofessional servicesperformance measurement

Candidates for SOFTWARE ENGINEERS
MOTTO HR CONSULTING (OPC) PRIVATE LIMITED 4.00 to 7.00 Years Gurugram 12 Oct, 2023

JOB DESCRIPTION: Location - Gurgaon Experience- 4 Years Must Skills - Dynamics 365, Dot Net, CRM Work from Office profile. Shift: General shift (Cab provided), Work from Offic...
crm.netdynamics 365

Candidates for Software Engineer
MOTTO HR CONSULTING (OPC) PRIVATE LIMITED 4.00 to 7.00 Years Gurugram 12 Oct, 2023

JOB DESCRIPTION: Location - Gurgaon Experience- 4 Years Must Skills - Dynamics 365, Dot Net, CRM Work from Office profile. Shift: General shift (Cab provided), Work from Offic...
crm.netdynamics 365

Vacant for _ _SOFTWARE ENGINEER _GURUGRAM
MOTTO HR CONSULTING (OPC) PRIVATE LIMITED 4.00 to 7.00 Years Gurugram 12 Oct, 2023

JOB DESCRIPTION: Location - Gurgaon Experience- 4 Years Must Skills - Dynamics 365, Dot Net, CRM Work from Office profile. Shift: General shift (Cab provided), Work from Offic...
crm.netdynamics 365

Automation Engineer
INFOCOMX TECHNOLOGIES PRIVATE LIMITED 4.00 to 8.00 Years Delhi 12 Oct, 2023

Job Title: Project Senior Engineer - Electrical Systems (Grain Processing Industry) Company Overview: SATAKE INDIA ENGINEERING is a leading engineering firm of Japanese origin specializing in pro...
project engineeringsite engineering

Candidates for _ Citrix engineer Gurugram
MOTTO HR CONSULTING (OPC) PRIVATE LIMITED Hiring For Motto 4.00 to 6.00 Years Gurugram 12 Oct, 2023

Responsibilities for citrix engineer

Application Packaging and deployments

Ideally you have experience in successfully transition to Cloud services for published desktop and ...
desktop engineeringit infrastructure operations

Candidates for __CITRIX ENGINEER GURUGRAM
MOTTO HR CONSULTING (OPC) PRIVATE LIMITED Hiring For Motto 4.00 to 6.00 Years Gurugram 12 Oct, 2023

Responsibilities for citrix engineer

Application Packaging and deployments

Ideally you have experience in successfully transition to Cloud services for pub...
desktop engineeringit infrastructure operations

Candidates for _ Citrix engineer Gurugram
MOTTO HR CONSULTING (OPC) PRIVATE LIMITED Hiring For Motto 4.00 to 6.00 Years Gurugram 12 Oct, 2023

Position -CITRIX L2 ,WORK-FROM-OFFICE, Grade:Sr. Engineer/Assistant Manager Responsibilities for citrix engineer

desktop engineeringit infrastructure operations

Applicants for Citrix engineer Gurugram
MOTTO HR CONSULTING (OPC) PRIVATE LIMITED Hiring For Motto 4.00 to 6.00 Years Gurugram 12 Oct, 2023

Responsibilities for citrix engineer

Application Packaging and deployments

Ideally you have experience in successfully transition to Cloud services for published desktop and ...
it infrastructure operationscitrix

Account Executive
Cocentrus Hiring For Delhi 1.00 to 3.00 Years Delhi 12 Oct, 2023

Hiring for Account Executive Profile for East Delhi IP Extension location. Please find the details as below :- Job Profile :Account Executive ...
gsttdstally erpbookkeepingaccount executives

Recruiting for Finance & Assoc Prof- Construction Technology
Amity University 3.00 to 8.00 Years Noida 12 Oct, 2023

Asstt Prof- Finance & Assoc Prof- Construction Technology, Contracts, Project Management, Cost Management RICS School of Built Environment (RICSSBE), Amity University Uttar Pradesh, Noida invites ...
financial statement analysistrial balancerisk managementcost managementstock valuationproject planningcapital budgetingproject management

Operation Associate
SAFE LEDGER PRIVATE LIMITED Fresher Gurugram 12 Oct, 2023

About the Company: Registerkaro is a leading provider of finance accounting and taxation services, dedicated to assisting businesses in their formation and compliance needs. We o...
operationsfinancial reporting

HIRING Backoffice Assistant-Faridabad
Shree Balaji Enterprises 0.00 to 3.00 Years Faridabad 12 Oct, 2023

Previous work experience as an Office Executive.

Excellent organizational skills.

Knowledge of computer operating systems and MS Office software.
ms officeback office

HIRING Backoffice Assistant-Delhi
Shree Balaji Enterprises 0.00 to 3.00 Years Delhi 12 Oct, 2023

Previous work experience as an Office Executive.

Excellent organizational skills.

Knowledge of computer operating systems and MS Office software.
ms officecrm

Autocad Draftsman
Ikamate HR India Pvt Ltd 2.00 to 7.00 Years Gurugram 12 Oct, 2023

Job Title: AutoCAD Draftsman Location: Vithalapur Office/PAN India Salary: Depends upon experience and skills Qualification: Diploma in Civil Engineering/ITI in Civil Engineering from reputed ...
cadautocad

Accountant
RISEOM TOOL CRAFTS PRIVATE LIMITED 3.00 to 8.00 Years Delhi 12 Oct, 2023

We are seeking trustworthy candidates who work efficiently without sacrificing accuracy. Accountants can expect to work with large amounts of numerical data, handle multiple tasks with deadlines,...
industrycommunicationgoodadaptabilitycollaborationknowledgesummaryskillsefficiencytime-saving

Back Office Executive Faridabad
Nirmala Staffing Services 0.00 to 3.00 Years Faridabad 12 Oct, 2023

Experience- 0 to 3 years Salary- 4lkh Job description
Back Office Executive Duties

Previous work experience as an Office Executive.

Excellent organizational skills. backendback-end operationsback office operations

Architect, Interior Designer
Jet Point Placement Hiring For None 1.00 to 5.00 Years Gurugram 12 Oct, 2023

We have urgent opening for Architect, Interior Designer for a reputed Company in South Delhi. Responsibilities: Architect, interior designdrawingcustomer relationssite

Accountant
S P Jagannath & Sons Hiring For Accountant 5.00 to 8.00 Years Delhi 12 Oct, 2023

ACCOUNTANT FRESHERS, PLEASE DO NOT APPLY SPJ Group has been a renowned group in the market since 19...
balance sheet finalisationtaxationaccountingaccounts finalisationbank reconciliationbranch accountingtaxgoods

Hiring for MIS-Data Analyst-Gurgaon Location
ASAP Staffing Solutions 0.00 to 4.00 Years Gurugram 12 Oct, 2023

Hi, We are currently hiring for MIS Executive role for Gurgaon Location. 5 days rotational shift Cab available Work from Office Mode Only B Com Graduate can apply with 1year MIS experienced....
financehlookupmismis reportingpivot tablebcomvlookup

US Accountant
Eveneum Solutions Private Limited 3.00 to 6.00 Years Delhi 12 Oct, 2023

Summary: We are looking for a highly motivated and experienced Bookkeeper/Accountant. The ideal candidate will have a strong understanding of US bookkeeping and accounting. asanaaccountingquickbooksexceladp payrollgood communication

Oracle EBS finance functional
LTIMindtree Limited 6.00 to 11.00 Years Delhi 12 Oct, 2023

LTIMindtree is hiring Oracle EBS Finance functional Role. Total exp : 5 to 12 Location: All LTI Offices (PAN india) Notice Period: Im...
accounts receivablegeneral ledgeroracle ebsaccounts payablefinance functionalebs financeebtax

Clinical Researcher
QUISCON BIOTECH 0.00 to 1.00 Years Delhi 12 Oct, 2023

We are looking for an organized, flexible Clinical Research Associate to oversee clinical trials. The Clinical Research Associate will develop and outline trial protocols, establish trial sites, ...
clinical research associatesclinical data managementclinical researchclinical trialsclinical monitoring

Operations Management
AVHAD ENTERPRISES 5.00 to 10.00 Years Delhi 12 Oct, 2023

Were searching for a high Tech. miner who will be responsible for smooth operation of our heavy machinery equipments that assist with the extraction and removal of various minerals, coal and valu...
operations researchlogistics operationsoperational excellence

REVIT Designer
GEETA ENGINEERING CORPORATION 10.00 to 20.00 Years Chennai 12 Oct, 2023

A Revit Designer is a professional who uses computer software to generate construction drawings. Specifically, this person utilized Autodesk Revit products to create 3D, photo-re...
project managementproject management plandelivery of projectsproject management trainingphases of project managementmanaging large scale projectsmanaging managersproject management officenuclear medicine

Walk-in interview start in Mumbai Required Rigger & Roustabout in offshore
APEX OFFSHORE SERVICE 0.00 to 1.00 Years Chennai 12 Oct, 2023

Greeting We are hiring for the position of RIGGER/ROUSTABOUT with a leading Oil & Gas Industry Job Responsibility:

-Chain...
oilindustrystcwgasoffshore platformsriggrsroustaboutesriggerrigers

Oracle EBS finance functional
LTIMindtree Limited 6.00 to 11.00 Years Chennai 12 Oct, 2023

LTIMindtree is hiring Oracle EBS Finance functional Role. Total exp : 5 to 12 Location: All LTI Offices (PAN india) Notice Period: Im...
accounts receivablegeneral ledgeroracle ebsaccounts payablefinance functionalebs financeebtax

Heavy Construction Manager
AWINMO INDIA MARKETING PRIVATE LIMITED 9.00 to 14.00 Years Chennai 12 Oct, 2023

Heavy Equipment Operator Job Description Template We are searching for a skilled heavy equipment operator to utilize our industrial gear....
negotiation skillsriskcommunication skillsorganizationleadership skillsexecutive managementfinancemanagementfinancialcritical

Autocad Draftsman
Ikamate HR India Pvt Ltd 2.00 to 7.00 Years Chennai 12 Oct, 2023

Job Title: AutoCAD Draftsman Location: Vithalapur Office/PAN India Salary: Depends upon experience and skills Qualification: Diploma in Civil Engineering/ITI in Civil Engineering from reputed ...
cadautocad

Accounts Executive
RyTe4U Consultants 2.00 to 4.00 Years Bangalore 12 Oct, 2023

Qualification BCom/M.Com or any other finance degree Experience 2 to 3 years experience Job description Role: Executive...
accounts payableaccounts receivableaccounts

Back Office Assistant-Bangalore
Shree Balaji Enterprises 0.00 to 3.00 Years Bangalore 12 Oct, 2023

Previous work experience as an Office Executive.

Excellent organizational skills.

Knowledge of computer operating systems and MS Office software.
back officecrm

Sr Operations Manager, Amazon Transportation Services
Amazon 0.00 to 4.00 Years Bangalore 12 Oct, 2023

At Amazon, were working to be the most customer-centric company on earth. To get there, we need talented, bright and driven people. Amazon is one of the most recognizable brand names in the world ...
salesdeliverycustomer relationsmarketingmanagementbias for actionsix sigmasite operationsdaily operationspeople managementquality standardscost optimizationprocess improvementbehavioral trainingcustomer experiencecontinuous improvementopti

Home Lending Risk Strategic Analytics - Associate
JPMorgan 0.00 to 4.00 Years Bangalore 12 Oct, 2023

The HL Risk Strategic Analytics team spans the globe, primarily sitting in Plano, TX and Bengaluru, India, however we have staff and executive presences across 9 locations worldwide: Plano TX, C...
source system analysismusic makingloan servicingrisk managementcapital marketsdata manipulationstrategic analyticsrelational databasescompatibility testingfinancial justificationmissassqlriskstemtrustoraclecredit

Accountant Manager,Assistant Accountant,Account Assistant
AppSoft Solutions 0.00 to 4.00 Years Bangalore 12 Oct, 2023

Job Description
Description:

To handle cash.

Dealing with the bankers.

Generation of MIS Reports.

En...
accountingtallyaccountssales

Manufacturing Domain Consultant - Scrum Master
Infosys Limited 0.00 to 2.00 Years Bangalore 12 Oct, 2023

The Process lead position is responsible for the proper process execution of the development for a designated part of the product portfolio roadmap. The process lead would review current Waters pr...
deliveryreportingaccountinganalyticsautomationproduct life cyclelife science industryiso 9001iso 13485life cyclescrum masterprogram managersproduct portfolioprocess excellenceinterpersonal skillsisoniceagilescrum

opportunity for BSc Frehser_Site/Shift incharge
ADARSH SOLUTIONS PRIVATE LIMITED 0.00 to 1.00 Years Bangalore 12 Oct, 2023

Hi, Candidates with BSC or Diploma in Electrical Designation: Staff Intern or Site Intern Description: In this position you will be learning and working with senior engineers in the field of El...
site inchargeelectrical

Heavy Construction Manager
AWINMO INDIA MARKETING PRIVATE LIMITED 9.00 to 14.00 Years Bangalore 12 Oct, 2023

Heavy Equipment Operator Job Description Template We are searching for a skilled heavy equipment operator to utilize our industrial gear....
negotiation skillsriskcommunication skillsorganizationleadership skillsexecutive managementfinancemanagementfinancialcritical

Autocad Draftsman
Ikamate HR India Pvt Ltd 2.00 to 7.00 Years Bangalore 12 Oct, 2023

Job Title: AutoCAD Draftsman Location: Vithalapur Office/PAN India Salary: Depends upon experience and skills Qualification: Diploma in Civil Engineering/ITI in Civil Engineering from reputed ...
cadautocad

PREV
NEXT

site accounting Job Openings

Construction Manager Job Description Template We are looking for an enthusiastic, organized construction manager to oversee all aspects of ou... decision-making skills.communication skills.leadership skills.business skills.technical skills.

Construction Manager [Intro Paragraph] The best job descriptions take two or three sentences to introduce prospective construction managers to ... delegation.industry knowledge.team management.risk management.communication.negotiation.flexibility.

Back Office Executive Duties Previous work experience as an Office Executive. Excellent organizational skills. backendback-end operationsback office operations

Heavy Equipment Operator Job Description Template We are searching for a skilled heavy equipment operator to utilize our industrial gear.... negotiation skillsriskcommunication skillsorganizationleadership skillsexecutive managementfinancemanagementfinancialcritical

Job Description

Heavy Equipment Operator Job Description Template We are searching for a skilled heavy equipment operator to utilize our industrial gear.... negotiation skillsriskcommunication skillsorganizationleadership skillsexecutive managementfinancemanagementfinancialcritical

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Construction Manager Job Description Template We are looking for an enthusiastic, organized construction manager to oversee all aspects of ou...
decision-making skills.communication skills.leadership skills.business skills.technical skills.

Construction Manager [Intro Paragraph] The best job descriptions take two or three sentences to introduce prospective construction managers to ...
delegation.industry knowledge.team management.risk management.communication.negotiation.flexibility.

Back Office Executive Duties

Previous work experience as an Office Executive.

Excellent organizational skills. backendback-end operationsback office operations

Heavy Equipment Operator Job Description Template We are searching for a skilled heavy equipment operator to utilize our industrial gear....
negotiation skillsriskcommunication skillsorganizationleadership skillsexecutive managementfinancemanagementfinancialcritical

Heavy Equipment Operator Job Description Template We are searching for a skilled heavy equipment operator to utilize our industrial gear....
negotiation skillsriskcommunication skillsorganizationleadership skillsexecutive managementfinancemanagementfinancialcritical