Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
Chennai | 2 Years of relevant experience
Experience: 1 - 5 years Location: Ahmedabad Education: B.E/ B.Tech/ ME/ MCA/ M.Tech / MCA / BCA Job- Type: Full Time Job Skills and Responsibility: CMS: WordPress/ Magento/ Opencart Frameworks: ...
mysqlphpjqueryjavascripthtmlwebsite creationcssyiiajaxoopssoundopencartPersonal WebsitesCustom WebsitesWebsite MonetizationBrochure WebsitesDynamic WebsitesGoogle Website Optimizerate Websites* Electromechanics/Electrotechnology, Senior Design Engineer TXT5 The Senior mechatronic designer essentially contributes to technical excellence by understanding and meeting customer needs and req...
autocadcaddrawingmodelingmechanicalnew product developmentverificationvalidationcontinuous improvement facilitationbom creationproject teamscommercial modelsWhat a Sales Manager do on day to day basis Net new business: - Understanding of company and its portfolio. Keep training yourself on different Services/applications and products - Identification o...
it service managementcustomer service managementinside salesvalue sellingaccount mininglead generationcustomer serviceasset managementsolution sellingaccount managementservice management4 6 years of experience in building technology products on open source technology Prior e-commerce domain experience Worked on scalable web based products and e-commerce sites Rich experience in LAM...
mysqlmagentojavascriptphpjqueryopen sourceeffective communicationsqlxmlyiicmsajaxlampzendlinuxdrupalapachejoomlawritingtrainingPHP Developer-Experienced Experience: 01-02 years Salary: 20000/ -30000/ -Per month Vacancy: 05 Keyskills: Core PHP, HTML5, CSS, JavaScript & JQuery, MySQL. Cake PHP, Codeignitor, Shop...
mysqlphpjqueryjavascripthtmlclient communicationcsszendhtml5magentocakephpshopifysymphonycodeignitercommunicationCodeIgniterLaravelSymfonye phpZend Frameware looking suitable candidates for Drupal Developer , details are mentioned below:- Required Skills and Experience on: Should have working experience on Drupal Sites 7.x or 8.x Experience in de...
gitphpjava scriptjquerydrupalcakephpsymfonylaravelcodeigniterjsonKey Work Processes : 1. Due diligence on features available in Symphony application and current status of deployment/bottlenecks 2. Benchmarking of Tanishq merchandise management processes with best ...
change managementcleaningjavasqlaccountsproduct lifecycle managementdue diligencework processesdaily operationsmanagement systemcustomer requirementsob Description: Disbursement of loans Sanctioning letters Repayment scheduling Documentation Candidate requirement: 2- 5 years of relevant experience in home loan disbursement in Domestic Hom...
salesaccountsbankingmistatlessonsstringsymphonyperformancecommunicationdisbursementrecitalsdocumentationoperationscommunication skillssolo performancemaster classesloan operationssolo recitalsart song
Roles & Responsibilities:-
Experience: 1 - 5 years Location: Ahmedabad Education: B.E/ B.Tech/ ME/ MCA/ M.Tech / MCA / BCA Job- Type: Full Time Job Skills and Responsibility: CMS: WordPress/ Magento/ Opencart Frameworks: ...
mysqlphpjqueryjavascripthtmlwebsite creationcssyiiajaxoopssoundopencartPersonal WebsitesCustom WebsitesWebsite MonetizationBrochure WebsitesDynamic WebsitesGoogle Website Optimizerate Websites
Roles and Responsibilities
- Excellent negotiation skills.
- Identify product improvements or new products by remaining current on industry trends, market activities, and competito...
android studiocomputer sciencecommunication skillsinterpersonal skillscustomer relationshipbusiness administrationagile scrumalgomvvmsalesagilescrumandroidmongodbtradingsciencebusinessmarketingnegotiationarchitecturePASSION EXCELLENCE What Youll be part of at symphony fintech Were are financial technology company with focus on capital market on a mission to reinvent the trading business is done through innova...
objectlow latencymusic makingcapital marketdata structuresproblem solvingdesign patternstrading systemsequipment supplyfinancial marketsaustralian equitiesfinancial technologyiented programmingbusinPASSION EXCELLENCE What Youll be part of at symphony fintech Were are financial technology company with focus on capital market on a mission to reinvent the trading business is done through innova...
htmlcssjavascriptjquerybootstrapobjectlow latencymusic makingcapital marketdata structuresproblem solvingdesign patternstrading systemsequipment supplyfinancial marketsaustralianiented programmingPASSION EXCELLENCE What Youll be part of at symphony fintech Were are financial technology company with focus on capital market on a mission to reinvent the trading business is done through innova...
inspectionqualitymaterials managementtypingswitchesobjectlow latencymusic makingcapital marketdata structuresproblem solvingdesign patternstrading systemsequipment supplyiented programmingfinancial
Roles and Responsibilities
- Excellent negotiation skills.
- Identify product improvements or new products by remaining current on industry trends, market activities, and competito...
swiftiosxcodeobjective cjsoncomputer sciencedigital conversioncommunication skillscustomer relationshipbusiness administrationagile scrumalgomvvmsalesagilescrummongodbtradingsciencePASSION EXCELLENCE What Youll be part of at symphony fintech Were are financial technology company with focus on capital market on a mission to reinvent the trading business is done through innova...
javascriptcssjqueryhtmlmysqlobjectlow latencymusic makingcapital marketdata structuresproblem solvingdesign patternstrading systemsequipment supplyfinancial marketsiented programmingaustralian equ
Job Description
Should have 3 -6 Years of Experience in PHP and 2-3 years in Symphony and wordpress
Strong database skills, proven experience with PHP, MYSQL, java Script, Jquery, ...
Experience: 2 - 4 years Open Position : 01 YB php developer - Youngbrainz Infotech Php Developer The post of Php Developer will involve the candidate to do the following: Roles And Capabilities E...
mysqlphpjqueryjavascripthtmlweb servicesmusic makingpersonal skillsweb applicationsdynamic websitessystem developmentmodule developmentmobile applicationsclient requirementsking experienceproject- Create dynamic and responsive web applications Involve in all aspects of development projects Participate in discussions and reviews Manage and maintain web sites Deliver timely projec...
mysqlphpjqueryjavascripthtmlweb applicationsdevelopment projectscssyiijavaajaxjoomlareviewssymphonyscriptingcodeigniterLAMPDHTMLRepresentational State TransferdpressDescription : We are looking for a PHP programmer with relevant experience and ability to develop complex web applications using standard frameworks and tools. Join us! Create dynamic and responsiv...
mysqlphpjqueryjavascripthtmlweb applicationsdevelopment projectscssyiijavaajaxjoomlareviewssymphonyscriptingcodeigniterLAMPDHTMLRepresentational State TransferdpressCreate dynamic and responsive web applications Involve in all aspects of development projects Participate in discussions and reviews Manage and maintain web sites Deliver timely project progress a...
mysqlphpjqueryjavascripthtmlweb applicationsdevelopment projectsyiidesignreviewscodeigniterintegrationLAMPDHTMLRepresentational State TransferColdFusionFacebook APIsymphonyJunior PHP Developer Brief description : Designation: Junior / Software Engineer Experience: 1+ yrs Location: Calicut Minimum Qualification: BE / BTech , MSc / MCA , PGDCA or any equivalent degre...
javasqljavascriptsql serverjquerybug fixingphpcssyiihtmlajaxoopszendmysqlpgdcadesignlaravelcakephped proceduresking experiencePosition:Web Engineer III The ideal candidate for this position should possess a good understanding of enterprise-class IT development methodo...
htmlcssjavascriptjquerymysqlsoftware development life cyclelife cycleunit testingdata modelingit developmentweb developmentsolution designdesign patternsweb applicationscommercial modelsproduction supportWEB DEVELOPER (Urgent Hiring) evelopment experience in CMS: WordPress/ Magento/ Opencart Experience of Magento 1.x 2.x themes and extension development project. Worked on Magento 1.x 2.x customizati...
csshtmljavascriptjquerymysqlpayment gatewaysclient requirementsphppsdajaxdesignsalarythemesmagentotwitterfacebooksymphonyopencarteducationcommunicationPHP JD - zend framework 2, angular, mysql- This is the minimum requirement Strong Knowledge in MySQL Database. Analyse, Create and Normalize database indepe...
angularjavascriptphpzendeskpostfixzend yii symphonyzend serverzendinstallationhtml5apache serverzend frameworkbindxmlzend studioapacheajaxsmartymysqlxhtmlhtmlzend certified engineernginxdatabasezend framework 2Responsible for smooth operation of the floor assigned.Responsible for the performance of floor boys. Supervise Room Attendants. Organises and facilitates the room ma...
performancelessonssolo performanceart songlyricalmaster classesrecitalssolo recitalsstringsymphonyResponsible for smooth operation of the floor assigned.Responsible for the performance of floor boys. Supervise Room Attendants. Organises and facilitates the room ma...
performancelessonssolo performanceart songlyricalmaster classesrecitalssolo recitalsstringsymphonyResponsible for smooth operation of the floor assigned.Responsible for the performance of floor boys. Supervise Room Attendants. Organises and facilitates the room ma...
performancelessonssolo performanceart songlyricalmaster classesrecitalssolo recitalsstringsymphonyResponsible for smooth operation of the floor assigned.Responsible for the performance of floor boys. Supervise Room Attendants. Organises and facilitates the room ma...
performancelessonssolo performanceart songlyricalmaster classesrecitalssolo recitalsstringsymphonyResponsible for smooth operation of the floor assigned.Responsible for the performance of floor boys. Supervise Room Attendants. Organises and facilitates the room ma...
performancelessonssolo performanceart songlyricalmaster classesrecitalssolo recitalsstringsymphony4 6 years of experience in building technology products on open source technology Prior e-commerce domain experience Worked on scalable web based products and e-commerce sites Rich experience in LAM...
mysqlmagentojavascriptphpjqueryopen sourceeffective communicationsqlxmlyiicmsajaxlampzendlinuxdrupalapachejoomlawritingtrainingResponsible for smooth operation of the floor assigned.Responsible for the performance of floor boys. Supervise Room Attendants. Organises and facilitates the room ma...
performancelessonssolo performanceart songlyricalmaster classesrecitalssolo recitalsstringsymphonyResponsible for smooth operation of the floor assigned.Responsible for the performance of floor boys. Supervise Room Attendants. Organises and facilitates the room ma...
performancelessonssolo performanceart songlyricalmaster classesrecitalssolo recitalsstringsymphony
Job Description Expert knowledge in PHP, MYSQL, Ajax, JQuery, MongoDB, Node.js and JavaScript. FrameWork Experience - CodeIgnitor, Yii, Symphony Experience with versioning (GIT) and Project Manageme...
mysqlphpjqueryjavascripthtmlopen sourceproject managementapplication programmingyiicmsajaxsoapjsonrestmobilejoomlamagentomongodbnodejsdpressPHP JD - zend framework 2, angular, mysql- This is the minimum requirement Strong Knowledge in MySQL Database. Analyse, Create and Normalize database indepe...
angularjavascriptphpzendeskpostfixzend yii symphonyzend serverzendinstallationhtml5apache serverzend frameworkbindxmlzend studioapacheajaxsmartymysqlxhtmlhtmlzend certified engineernginxdatabasezend framework 2Golden Job Oppertunity for Sr. Software Engineer(PHP) @ Ahmedabad - TOPS Technologies Request a Call back Golden Job Oppertunity for Sr. Software Engineer(PHP) @ Ahmedabad April 23 , 2013 We are TOPS ...
front endtest casesit trainingdetail designshopping cartaudio masteringcontent managementfunctional requirementsphpsqlcrectchtmlzendmailtopsRoles and Responsibilities
* Job Purpose (In a brief, specific one or two-sentence statement, answer the questions: Why does this position exist and What is it expected to accomplish ) ITT (Investment Trading Tec...
javajavascriptsqlcustomer relationshtmlroot cause analysisunix shell scriptingit supportroot causeback officemarket riskfront officerisk managementshell scriptingRoles and Responsibilities
Roles and Responsibilities
Measuring the performance of mechanical components, devices. maintaining and modifying equipment using computer-aided design/modelling software-Solidworks producing and implementing designs and test p...
master classescomponentspumpspreventive maintenanceinterior trimnvhevaluationsolo performanceassembliesinspectionmechanicalhevchassissteeringpassive componentssafetystampingperformancesymphonyMeasuring the performance of mechanical components, devices. maintaining and modifying equipment using computer-aided design/modelling software-Solidworks producing and implementing designs and test p...
hevsteeringsolo performancestampingmechanicalmaster classesevaluationassembliesinterior trimcomponentsperformancechassissafetyinspectionpassive componentsnvhcommissioningsitesymphonyMeasuring the performance of mechanical components, devices. maintaining and modifying equipment using computer-aided design/modelling software-Solidworks producing and implementing designs and test p...
master classescomponentspumpspreventive maintenanceinterior trimnvhevaluationsolo performanceassembliesinspectionmechanicalhevchassissteeringpassive componentssafetystampingperformancesymphonyMeasuring the performance of mechanical components, devices. maintaining and modifying equipment using computer-aided design/modelling software-Solidworks producing and implementing designs and test p...
hevsteeringsolo performancestampingmechanicalmaster classesevaluationassembliesinterior trimcomponentsperformancechassissafetyinspectionpassive componentsnvhcommissioningsitesymphonyMeasuring the performance of mechanical components, devices. maintaining and modifying equipment using computer-aided design/modelling software-Solidworks producing and implementing designs and test p...
master classescomponentspumpspreventive maintenanceinterior trimnvhevaluationsolo performanceassembliesinspectionmechanicalhevchassissteeringpassive componentssafetystampingperformancesymphonyMeasuring the performance of mechanical components, devices. maintaining and modifying equipment using computer-aided design/modelling software-Solidworks producing and implementing designs and test p...
hevsteeringsolo performancestampingmechanicalmaster classesevaluationassembliesinterior trimcomponentsperformancechassissafetyinspectionpassive componentsnvhcommissioningsitesymphonyExperience :Minimum 3 years of experience in the respective field. We are looking for Senior Php developers for the consulting division of Kolkata, India. The appointed candidate will be reporting to ...
javasqljavascriptsql serverjqueryweb application securitylife cycledata modelingweb applicationcommercial modelsapplication securityrequirements analysisproject administrationoptimization strategiesper© 2019 Hireejobs All Rights Reserved