technical accounting research jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

technical accounting research Job Openings

Showing 54251 - 54300 of 58261 Jobs

Carpenter Foreman in Dubai

Always International Manpower Service Hiring For Electrician Plumber Mason Welder job in Dubai 1.00 to 5.00 Years Hyderabad 12 Oct, 2023

Production Supervisor, Production Manager, Production Executive

ARYAN TECHNOLOGY 0.00 to 4.00 Years Hyderabad 12 Oct, 2023

Production Manager Job Responsibilities:

Supports the senior producer and assists the team by focusing on schedules, velocity tracking, and dependency management

high level of organization

handle multiple projects

quality control

dependency management

Senior Construction Manager

AWINMO INDIA MARKETING PRIVATE LIMITED 9.00 to 14.00 Years Hyderabad 12 Oct, 2023

Construction Manager Job Description Template We are looking for an enthusiastic, organized construction manager to oversee all aspects of ou...
decision-making skills.communication skills.leadership skills.business skills.technical skills.

Manager, Construction Management, Self Perform

AWINMO INDIA MARKETING PRIVATE LIMITED 9.00 to 14.00 Years Hyderabad 12 Oct, 2023

Construction Manager [Intro Paragraph] The best job descriptions take two or three sentences to introduce prospective construction managers to ...
delegation.industry knowledge.team management.risk management.communication.negotiation.flexibility.

Accountant ( Infrastructure )

PRO APEX INFRA LLP 3.00 to 6.00 Years Hyderabad 12 Oct, 2023

Role: Accountant ( Infrastructure )

Experience needed: 3 - 6 years

Department: Infrastructure Constructions & Site Engineering

Educat...
ms officegstconstructiontallybook keepingaccounting

Spotfire Admin
Quess Corp (Magna Infotech) 3.00 to 8.00 Years Hyderabad 12 Oct, 2023

Spotfire Admin Exp- 3 to 8 yrs Location - Andhra Pradesh,Haryana,Karnataka,Maharashtra,Tamil Nadu,West Bengal Hyderabad,Gurgaon,Bangalore,Mumbai,Pune,Chennai Np- 15days to immediate Technical...
spotfire.netjavaironpython

Territory Business Manager - Hyderabad - Victora
Abbott Healthcare 0.00 to 4.00 Years Hyderabad 12 Oct, 2023

MAIN PURPOSE OF ROLE Summarize the main purpose of the role. Conduct market research and feasibility studies to analyze the viability of alternative busi...
salesmarketingbusiness developmenttargetretailbase paymarket researchsenior managementfeasibility studiespayresearchbusinessstrategymaterialsviabilitymanagementoperationspresentationsPricing

Practitioner Finance and Administration Delivery
IBM India Pvt Limited 0.00 to 4.00 Years Hyderabad 12 Oct, 2023

Introduction The Finance & Admin Business Analyst is essential to the ongoing profitable operations for one of the most globally recognized and respected companies in the world. By overseeing our ...
time managementfixed assetsservice leveldesign thinking

Marketing Executive/Manager Function Marketing
NTECH IT SOLUTIONS PRIVATE LIMITED 2.00 to 5.00 Years Hyderabad 12 Oct, 2023

Job Purpose:

To plan and develop all marketing, advertising, promotional

activities for effectively executing and monitoring the marketing

strateg...
marketingpromotion planning

Salesforce Commerce Cloud Lead Developer
HCL Technologies Ltd 5.00 to 10.00 Years Hyderabad 12 Oct, 2023

Hi All, Greetings! HCL Technologies Pvt Ltd. India, we are hiring for the below job role Location : Bengaluru/Hyderabad/Chennai/Pune/Noida Primary Skill :B2B Commerce (Cloud Craze) .
<...
lightingvisualforceapex data loadersalesforcearchitectural lighting

Oracle EBS finance functional
LTIMindtree Limited 6.00 to 11.00 Years Hyderabad 12 Oct, 2023

LTIMindtree is hiring Oracle EBS Finance functional Role. Total exp : 5 to 12 Location: All LTI Offices (PAN india) Notice Period: Im...
accounts receivablegeneral ledgeroracle ebsaccounts payablefinance functionalebs financeebtax

Vulnerability Management - Qualys
LTIMindtree Limited 3.00 to 5.00 Years Hyderabad 12 Oct, 2023

Dear Candidate, We are hiring for the position ofVulnerability Management - Qualys at LTI Mindtree

3-4 years of Vulnerability Management (VM) expe...
modulequalysvulnerability managementstrikecrowdwiz.io

Java Senior Consultant
Infosys Limited 2.00 to 6.00 Years Hyderabad 12 Oct, 2023

We are looking for a Java technical Consultant with experience on Springboot as well, who will be responsible for building applications and leading development teams. Will have to leverage his or ...
sapcustomer relationsdeliverysalessqlteam leading skillslife cycleteam leadinguser requirementsproduct developmentcommunication skillsdevelopment projectswritten communicationhisjavacodesdesignfeaturesconsulting

AWS/ Amazon Web Services Developer
Infosys Limited 2.00 to 5.00 Years Hyderabad 12 Oct, 2023

Skills: AWS Nice to Have Skills: Python, Pyspark, Java, SQL, ETL, Hadoop , AWS certification Technical & Professional requirements: AWS, DataBricks, AWS Redshift Experience in Building AWS stack u...
project life cyclesoftware quality assurancedynamo dblife cycleweb servicesdata modelingtesting toolscloud storagedata migrationcloud securityproblem solvingtechnical skillssoftware qualityissue resolutionquality assurancesolution delivery

GCP Architect
Infosys Limited 5.00 to 17.00 Years Hyderabad 12 Oct, 2023

A day in the life of an Infoscion As part of the Infosys delivery team, your primary role would be to provide best fit architectural solutions for one or more projects. You would also provide tech...
problem solvingdesign patternsperformance tuningthought leadershiparchitectural designsolution developmentdigital transformationcompetency developmentfitsdlcclouddesignsizingdatabasecomplianceleadershipperformancearchitectureconsultation

.Net Project Manager
Infosys Limited 5.00 to 13.00 Years Hyderabad 12 Oct, 2023

We are seeking a highly experienced .NET Project Manager to join our team. As a Project Manager, you will be responsible for leading and managing the development of .NET projects from start to fin...
deliveryproject managementcustomer relationsreportingjavasubject matter expertsidentifying new opportunitiessoftware development methodologiesproject planscloud computingproblem solvingversion controlproject planningagile methodologiessoftwa

Integrated Security Risk Management Security Architect
Accenture 8.00 to 10.00 Years Gurugram 12 Oct, 2023

About Accenture: Accenture is a global professional services company with leading capabilities in digital, cloud and security. Combining unmatched experience and specialized skill...
deliverydocumentationsiemsolution designaaadisaster recovery planningbusiness continuity planninginformation systems managementcloud securityrisk assessmentcomputer sciencedisaster recoveryrecovery planningimpact assessmentsecurity controls

Asst Manager - Private Equity Fund Accountin
NTT Global Delivery Services Limited 0.00 to 4.00 Years Gurugram 12 Oct, 2023

Roles and Responsibilities

Review Booking Journal Entries basis bank statements and client

Review of Bank Reconciliation and maintaining the respectiv...
cash flowhedge fundsprivate equityjournal entriesbank statementsfinancial reportingbank reconciliationfinancial justificationcashcapitalbespokeexpensesreportingportfoliomanagementmonitoringmaintenanceperformanceliabilities

Data Scientist Artificial Intelligence
IBM India Pvt Limited 6.00 to 8.00 Years Gurugram 12 Oct, 2023

Introduction In this role, you ll work in our IBM Client Innovation Center (CIC), where we deliver deep technical and industry expertise to a wide range of public and private sector clients around...
machine learningpythondata analysissqlanalyticsopen sourcedeep learningprivate sectordata governancework effectivelycustomer satisfactionnlpweatherbusinessfeaturesadoptionownership

Hire for _Software Engineer
MNR Solutions Pvt Ltd 1.00 to 5.00 Years Delhi 12 Oct, 2023

Design, implement, and maintain software systems using Typescript, React, AWS, Docker, and Node/Express.

Work with little to no oversight to rapidly deliver softwar...
software engineerssoftware engineeringsoftware development

Software Developer
MNR Solutions Pvt Ltd 1.00 to 5.00 Years Delhi 12 Oct, 2023

Developer Level A/SA/M Exp Range 3 yrs to 13 yrs Work Location Pan India Primary Skill Java , Android, IOS, Angular. Js, React. JS, React native, Xamarin, Devops, Scrum Master, Node JS...
technical skillssoftware development

Candidates for SOFTWARE ENGINEERS
MOTTO HR CONSULTING (OPC) PRIVATE LIMITED 4.00 to 7.00 Years Gurugram 12 Oct, 2023

JOB DESCRIPTION: Location - Gurgaon Experience- 4 Years Must Skills - Dynamics 365, Dot Net, CRM Work from Office profile. Shift: General shift (Cab provided), Work from Offic...
crm.netdynamics 365

Candidates for Software Engineer
MOTTO HR CONSULTING (OPC) PRIVATE LIMITED 4.00 to 7.00 Years Gurugram 12 Oct, 2023

JOB DESCRIPTION: Location - Gurgaon Experience- 4 Years Must Skills - Dynamics 365, Dot Net, CRM Work from Office profile. Shift: General shift (Cab provided), Work from Offic...
crm.netdynamics 365

Vacant for _ _SOFTWARE ENGINEER _GURUGRAM
MOTTO HR CONSULTING (OPC) PRIVATE LIMITED 4.00 to 7.00 Years Gurugram 12 Oct, 2023

JOB DESCRIPTION: Location - Gurgaon Experience- 4 Years Must Skills - Dynamics 365, Dot Net, CRM Work from Office profile. Shift: General shift (Cab provided), Work from Offic...
crm.netdynamics 365

Machine Learning Engineer
Vaishnavi Services 18.00 to 25.00 Years Gurugram 12 Oct, 2023

Machine Learning Engineer is someone who designs machine learning systems. Machine Learning Engineer or Machine Learning Developer is someone who collects and extracts data and makes use of that ...
maintenance engineeringmachine learningmachine designmachine maintenancemechanism designinformation extractionopto-mechanical designcondition monitoringplanned preventative maintenance

Desktop Support Engineer
RK Growing Career Solutions 2.00 to 3.00 Years Delhi 12 Oct, 2023

We have an Urgent Required for Desktop Support Engineer (Field Job) Experience: 2 to 4 years Job Location: Delhi NSP Salary: 18k to 25k Convince Candidate should have good knowledge. Provid...
disassemblingprinter supportoutlookfirewallassemblingwindowshardware

Data Scientist
Sunil Kumar and arpit 1.00 to 5.00 Years Noida 12 Oct, 2023

About this opportunity Ericsson is looking for Data Scientist who can Perform Data science leadership, Analyze and recommend design considerations for scalability, performance, streaming, and alg...
Data ScienceFeature SelectionNetwork ArchitectureData WranglingForecastingClassificationData MiningText MiningNLPDecision TreesSearch AlgorithmsNeural NetworksPredictive AnalyticsWeb AnalyticsRegressionTime SeriesBig Data AnalyticsPython

Automation Engineer
INFOCOMX TECHNOLOGIES PRIVATE LIMITED 4.00 to 8.00 Years Delhi 12 Oct, 2023

Job Title: Project Senior Engineer - Electrical Systems (Grain Processing Industry) Company Overview: SATAKE INDIA ENGINEERING is a leading engineering firm of Japanese origin specializing in pro...
project engineeringsite engineering

Requirement for Assistant Professor
Amity University 2.00 to 3.00 Years Noida 12 Oct, 2023

Applications invited for Assistant Professor - Psychology at Amity Institute of Psychology and Allied Sciences (AIPS) 26.04.2023 AMITY UNIVERSITY Inviting Applications for Assistant Professor We a...
teachingresearchcommunicationEntity Framework

Requirement for Scientific Administrative Assistant position
Amity University 5.00 to 7.00 Years Noida 12 Oct, 2023

Applications invited for Scientific Administrative Assistant position AFAF 25-04-2023 - Adv/AUUP/HR/23/225 Advertisement Date: 25-04-2023 Adv/AUUP/HR/23/225 Amity Food & Agriculture Foundation Inv...
analyticalresearchadministration

Applications invited for JRF position at AIOA
Amity University 2.00 to 6.00 Years Noida 12 Oct, 2023

Applications invited for JRF position at AIOA - 01-02-2023 - Adv/AUUP/HR/23/208 Advertisement Date: 01-02-2023 Adv/AUUP/HR/23/208 Amity Institute of Organic Agriculture Invites Applications for Ju...
molecular biologynethraagencybiologyfundingresearchmolecularmanagementagricultureexplorationmicrobiologycompensationWindows Communication Foundation

Requirement for JRF position
Amity University 1.00 to 2.00 Years Delhi 12 Oct, 2023

Applications invited for JRF position at AIARS - CMPDI - 04-04-2023 - Adv/AUUP/HR/23/221 Advertisement Date: 04-04-2023 Adv/AUUP/HR/23/221 Amity Institute for Advanced Research and Studies (Materi...
carbon nanotubesmine planningplanningdesignnet

Applications invited for SRF position
Amity University 2.00 to 5.00 Years Noida 12 Oct, 2023

Applications invited for SRF position at AIB - 06-12-2022 - Adv/AUUP/HR/22/0195 Advertisement Date: 06-12-2022 Adv/AUUP/HR/22/0195 Amity Institute of Biotechnology Invites Applications for Senior ...
biomedical sciencesformulationfundingculture techniqueslife sciencesassessment

Apply for-Faculty
Amity University 2.00 to 4.00 Years Noida 12 Oct, 2023

Faculty for Amity Institute of Hospital Administration - 06-12-2022 Amity Institute of Hospital Administration, Amity University, Noida Applications are invited from suitable candidates for Facult...
hospital administrationadministrationPhysician RelationsHealthcare ConsultingRevenue CycleWorking with PhysiciansJCAHOQuality Improvement

Account Executive
Cocentrus Hiring For Delhi 1.00 to 3.00 Years Delhi 12 Oct, 2023

Hiring for Account Executive Profile for East Delhi IP Extension location. Please find the details as below :- Job Profile :Account Executive ...
gsttdstally erpbookkeepingaccount executives

back Office Assistant
Synergy Plus Business Consulting Group Hiring For school 1.00 to 5.00 Years Gurugram 12 Oct, 2023

Greetings Everyone - BACK DESK ASSISTANT(FENALE ) is required for a Renowned School for GURGAON location Interested candidates can apply - hidden_email( backend operationsback officeback office operationsdata entry

Applications invited for Asst. Professor / Associate Professor / Professor
Amity University 3.00 to 8.00 Years Noida 12 Oct, 2023

Applications invited for Asst. Professor / Associate Professor / Professor at ASAP 21.04.2023 AMITY UNIVERSITY Inviting Applications for Assistant / Associate Professor / Professor Amity Universit...
teachingresearchmarketingseminarsbasicurban designbuilding engineeringlandscape architecturebemasapurbanvisitdesignscopusresumeplanningengineeringarchitecturepublications

Recruiting for Finance & Assoc Prof- Construction Technology
Amity University 3.00 to 8.00 Years Noida 12 Oct, 2023

Asstt Prof- Finance & Assoc Prof- Construction Technology, Contracts, Project Management, Cost Management RICS School of Built Environment (RICSSBE), Amity University Uttar Pradesh, Noida invites ...
financial statement analysistrial balancerisk managementcost managementstock valuationproject planningcapital budgetingproject management

Applications invited for Assistant Professor / Associate Professor
Amity University 2.00 to 5.00 Years Noida 12 Oct, 2023

Applications invited for Assistant Professor / Associate Professor at Amity Center for Nanomedicine - 06-12-2022 Advertisement date : 03-12-2020 Ref. No. : Adv/AUUP/HR/20/018 AMITY UNIVERSITY Invi...
teachingresearchseminarselectronicsbasicnucleic aciddrug discoverymolecular biologycomputational chemistryvisitresumebiology

Faculty - Amity Institute of Travel and Tourism
Amity University 5.00 to 11.00 Years Noida 12 Oct, 2023

Faculty - Amity Institute of Travel and Tourism, Amity University, Noida - 06-12-2022 Amity Institute of Travel and Tourism, Amity University, Noida Invites applications from suitable candidates f...
tourism managementexisttourismresearchplanningjournalsvacanciesmanagementhospitalityaustralasiaconsiderationTourism MarketingHeritage TourismSustainable Tourism

Applications invited for JRF position at AISST
Amity University 2.00 to 6.00 Years Noida 12 Oct, 2023

Applications invited for JRF position at AISST - ISRO - 10-04-2023 - Adv/AUUP/HR/23/223 Advertisement Date: 10-04-2023 Adv/AUUP/HR/23/223 Amity Institute of Space Science and Technology Invites Ap...
compensationspace weatherspace environment

Invite Applications for Assistant Professor in Oceanography
Amity University 3.00 to 6.00 Years Noida 12 Oct, 2023

Invite Applications for Assistant Professor in Oceanography - 06-12-2022 Advertisement Date : 06-12-2022 Ref. No. : Adv/AUUP/HR/19/028 AMITY UNIVERSITY Inviting Applications for Assistant Professo...
teachingresearchseminarselectronicsbasicmarine biologyatmospheric sciencemailoceanvisitresumebiologysciencechemistryoceanographypublicationsMarine Conservation

Operation Associate
SAFE LEDGER PRIVATE LIMITED Fresher Gurugram 12 Oct, 2023

About the Company: Registerkaro is a leading provider of finance accounting and taxation services, dedicated to assisting businesses in their formation and compliance needs. We o...
operationsfinancial reporting

HIRING Backoffice Assistant-Faridabad
Shree Balaji Enterprises 0.00 to 3.00 Years Faridabad 12 Oct, 2023

Previous work experience as an Office Executive.

Excellent organizational skills.

Knowledge of computer operating systems and MS Office software.
ms officeback office

HIRING Backoffice Assistant-Delhi
Shree Balaji Enterprises 0.00 to 3.00 Years Delhi 12 Oct, 2023

Previous work experience as an Office Executive.

Excellent organizational skills.

Knowledge of computer operating systems and MS Office software.
ms officecrm

Salesforce Commerce Cloud Lead Developer
HCL Technologies Ltd 5.00 to 10.00 Years Gurugram 12 Oct, 2023

Hi All, Greetings! HCL Technologies Pvt Ltd. India, we are hiring for the below job role Location : Bengaluru/Hyderabad/Chennai/Pune/Noida Primary Skill :B2B Commerce (Cloud Craze) .
<...
lightingvisualforceapex data loadersalesforcearchitectural lighting

Android Developer
HAPPY SQUARE OUTSOURCING SERVICES PRIVATE LIMITED 4.00 to 5.00 Years Gurugram 12 Oct, 2023

Job Role – Android developer (mobile devices and TV). Preferred domain experience: OTT , Media , Video , Audio space Good analytical ability to attack problems that are very unusual and ex...
AndroidAndroid StudioJavaAndroid frameworkJavaJavaJavaScriptJSONHTMLKotlinFireTv

Accountant
RISEOM TOOL CRAFTS PRIVATE LIMITED 3.00 to 8.00 Years Delhi 12 Oct, 2023

We are seeking trustworthy candidates who work efficiently without sacrificing accuracy. Accountants can expect to work with large amounts of numerical data, handle multiple tasks with deadlines,...
industrycommunicationgoodadaptabilitycollaborationknowledgesummaryskillsefficiencytime-saving

Business Development Manager
Vimuktaye Solutions Hiring For Suchalis Artisian Bakehouse 4.00 to 9.00 Years Gurugram 12 Oct, 2023

Dear Candidates, We are urgently hiring for Business Development Manager for a reputed Corporate Company Profile :Business Development Manager . Experience : Min 5 Year Salary: Best in the Indu...
business developmentdemand generationcustomer relationshipsales planninglead generation

Technical Sales Representative
Job Search 1.00 to 4.00 Years Delhi 12 Oct, 2023

HI, we have an urgent job opening for a position of Technical sales Representative postion with one of our client who are the leading distributors of Raw material , chemicals used in Pharma , co...
chemical salesapisalesflavorscoatingdyespigmentspaintsmaterial

PREV
NEXT

technical accounting research Job Openings

Construction Manager Job Description Template We are looking for an enthusiastic, organized construction manager to oversee all aspects of ou... decision-making skills.communication skills.leadership skills.business skills.technical skills.

Construction Manager [Intro Paragraph] The best job descriptions take two or three sentences to introduce prospective construction managers to ... delegation.industry knowledge.team management.risk management.communication.negotiation.flexibility.

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Construction Manager Job Description Template We are looking for an enthusiastic, organized construction manager to oversee all aspects of ou...
decision-making skills.communication skills.leadership skills.business skills.technical skills.

Construction Manager [Intro Paragraph] The best job descriptions take two or three sentences to introduce prospective construction managers to ...
delegation.industry knowledge.team management.risk management.communication.negotiation.flexibility.