understanding of local language jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

understanding of local language Job Openings

Showing 37001 - 37050 of 58175 Jobs

Medical Coding for Nutrition and Dietitian Wanted -CT Priya

Alpha Medical Coding Solutions 0.00 to 2.00 Years Chennai,Vellore, Thanjavur, Madurai, Salem, Thoothukudi, Tiruchirappalli, Coimbatore, Bangalore, Hyd 29 Oct, 2024

Medical Coding Job

hidden_mobile

Position: Medical Coder

Medical Coder - Bsc, Physician Assistant , Medical coding - Ct Priya HR

Alpha Medical Coding Solutions 0.00 to 2.00 Years Chennai,Tirupati, Vellore, Thoothukudi, Salem, Kanyakumari, Tiruchirappalli, Kanchipuram, Coimbatore 29 Oct, 2024

hidden_mobile

Medical coder ANM GNM Bsc Nursing Staff Nurse -Ct JayaPriya

Alpha Medical Coding Solutions 0.00 to 4.00 Years Chennai,Pondicherry, Cuddalore, Salem, Kanyakumari, Nagercoil, Kanchipuram, Vilupuram, Coimbatore, K 29 Oct, 2024

hidden_mobile

hidden_email

medical coder for B.E B.Tech Biomedical biotechnology Bioinformatics- CT Jp

Alpha Medical Coding Solutions 0.00 to 2.00 Years Chennai,Vellore, Thanjavur, Madurai, Salem, Thoothukudi, Tiruchirappalli, Coimbatore, Bangalore, Hyd 29 Oct, 2024

Medical Coding Job

CT HR JayaPriya-hidden_mobile(Whatsapp )

Position: Medical Coder

medical codingbiochemistrypharmacybiomedicalmptbiotechnologyzoologynursingphysiotherapy

Medical Coders - Freshers-Ct JayaPriya
Alpha Medical Coding Solutions 0.00 to 4.00 Years Chennai,Pondicherry, Cuddalore, Salem, Kanyakumari, Kanchipuram, Nagercoil, Vilupuram, Coimbatore, K 29 Oct, 2024

Alpha coding Solutions HR Jayapriya CT -hidden_mobile (Whatsapp ur resume) hidden_email Main branch address:- No-17,JK Complex Ramanat...
biotechnologyphysiotherapymedical codingbptbhmsbamsbioinformaticsbiochemistrymicrobiology

Accounts & Administration Executive
ARYAN TECHNOLOGY 0.00 to 4.00 Years Chennai,Bangalore, Noida, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Delhi 29 Oct, 2024

Accountant Responsibilities:

Complying with all company, local, state, and federal accounting and financial regulations.

C...
tallyaccountingauditing

Medical Coding Critical Care,Clinical Care Technology- Ct Priya
Alpha Medical Coding Solutions 0.00 to 2.00 Years Chennai,Tirupati, Vellore, Thoothukudi, Salem, Kanyakumari, Tiruchirappalli, Kanchipuram, Coimbatore 29 Oct, 2024

Alpha coding Solutions HR Gokulapriya hr hidden_mobile( Whatsapp ur resume) Main branch address:-No-17,JK Complex Ramanathan streetT nager Chennai -17 Medical Code...
biomedicalbiologybiochemistrynursingpharmacyphysiotherapymedical codingbiotechnology

Medical Coding For Nursing, BPT, Pharmacy Grad -Ct JayaPriya
Alpha Medical Coding Solutions 0.00 to 4.00 Years Chennai,Pondicherry, Cuddalore, Salem, Kanyakumari, Nagercoil, Kanchipuram, Vilupuram, Coimbatore, K 29 Oct, 2024

Alpha coding Solutions HR Jayapriya CT -hidden_mobile (Whatsapp ur resume) hidden_email Main branch address:- No-17,JK Complex Ramanat...
microbiologybhmsbiotechnologybiochemistryphysiotherapybptbamsmedical codingbioinformatics

Medical coding -karthiga HR
Alpha Medical Coding Solutions 0.00 to 4.00 Years Chennai,Pondicherry, Cuddalore, Salem, Kanyakumari, Nagercoil, Kanchipuram, Vilupuram, Coimbatore, K 29 Oct, 2024

Alpha coding Solutions HR Karthiga CT -hidden_mobile (hidden_mobile Whatsapp ur resume) hidden_email Main br...
medical codinglife science industrybiomedicalbiotechnology industry

EWM Functional Consultant
LTIMindtree Limited 5.00 to 10.00 Years Chennai,Bangalore, Noida, Hyderabad, Kolkata, Mumbai City 29 Oct, 2024

Greetings from LTIMindtree!! We have an urgent requirement for EWM Functional Consultant Experience: 5yrs Hiring Location-Across LTIMindtree

SAP EWM Experience of working with Decen...
saphana

Medical Coder - Biomedical, Biotech, Bio-Chem Grad- CT Priya
Alpha Medical Coding Solutions 0.00 to 2.00 Years Bangalore,Salem, Vellore, Thanjavur, Madurai, Chennai, Thoothukudi, Hyderabad, Tiruchirappalli, Coim 29 Oct, 2024

Medical Coding Job CT HR Gokulapriya-hidden_mobile(Whatsapp ) Position: Medical Coder zoologymedical codingbptpharmacynursingbiochemistryphysiotherapymptbiotechnology

Development Director
NEW ERA LIFE CARE PRIVATE LIMITED 22.00 to 0.00 Years Bangalore,Chennai, Noida, Hyderabad, Kolkata, Gurugram, Pune, Dhubri, Mumbai City, Delhi 29 Oct, 2024

We are looking for a person who is as passionate and enthusiastic about our organizations mission as we are, someone with an understanding of the importance this work has in driving change in com...
marketingroidigitalservicebusinessdevelopmentoversightcustomermanagementgenerationexcellentpatientsleadprojectprofessional

Assistant Manager Finance
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 6.00 Years Bangalore,Noida, Chennai, Hyderabad, Gurugram, Pune, Mumbai City, Delhi 29 Oct, 2024

Revenue Accounting:

Record and monitor revenue transactions to ensure they are recognized in the correct accounting periods.

Prepare and review journal entri...
advanced exceloperationstds calculationtallypreparationtdsvoucherbillingexcel reportprocurementfinancial reporting

Office Assistant
LEADZN PRIVATE LIMITED 6.00 to 11.00 Years Bangalore,Chennai, Noida, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City, Delhi 29 Oct, 2024

We are looking for a competent Office Assistant to help with the organization and running of the daily administrative operations of the company.
What does an office assistant do
The i...
yield managementschedulingoperationsfrontofficesales coordinationfront office managementsalesdevelopmentbusinessmanagersupervisorproposalaccount

Lease Administrator
GALLAGHER AND MOHAN PRIVATE LIMITED 4.00 to 9.00 Years Bangalore,Noida, Chennai, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Delhi, Port Blair 29 Oct, 2024

Lease Administrator
What we are and what we do:- Gallagher & Mohan works exclusively within the real estate industry. Our mission is to provide financial analysis, mark...
lease administrationadministration

Service Engineer- Bangalore ( Coffee Machines ) - On rolls-ITI Can apply
MONALISA MANPOWER MANAGEMENT LLP 1.00 to 6.00 Years Bangalore 29 Oct, 2024

Dear Candidate, Greetings of The Day.!! We have an Urgent opening for the position of Service Engineer at One of our reputed clients @Bangalore - Location. Hiring Company Name Confidential...
installationafter sales servicerepairfield technicianscommissioningfield servicemaintenancecoffee machinetechnician

Field Operator
OVERNET TRADING PRIVATE LIMITED 24.00 to 25.00 Years Bangalore,Raipur, Vapi, Hyderabad, Gurugram, Mumbai City, Mahesana, Delhi, Vasco Da Gama, Khagaria 29 Oct, 2024

Field Operator I sets up, operates and troubleshoots a variety of machines and/or equipment on customer site in accordance with established procedures and guidelines. Reads and interprets blu...
marketinglabfielddataentryassistancestoreproductionwelderoperatorcategorymanagerforemanclerkassistant

Regional Marketing Manager
LEADZN PRIVATE LIMITED 10.00 to 20.00 Years Bangalore,Zimbabwe, Mozambique, Afghanistan, Chennai, Noida, Hyderabad, Gurugram, Kolkata, Pune, Mum 29 Oct, 2024

We are looking for a goal-oriented regional marketing manager to implement marketing campaigns in accordance with the regions demographics. In this role, your responsibilities will include foreca...
regional marketingmarketingsales administrationlogistics managementdistribution managementsales coordinationregional managementpublictransportation managementcoordinatormanagerrelationsexecutive

Child Life Specialist
NEW ERA LIFE CARE PRIVATE LIMITED 11.00 to 21.00 Years Bangalore,Chennai, Noida, Nellore, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City, Delhi 29 Oct, 2024

We are looking for a Child Life Specialist to join our team and help our pediatric patients have a more relaxing and effective recovery time while in our healthcare facility. Child Life Speciali...
collaborationleadershipcommunicationadvocacytherapydevelopmentpatienceemotionalservicesfamilylifeempathychildplayengaging

Reservation Associate
JAI AMBEY EMERGENCY SERVICES (I) PRIVATE LIMITED 2.00 to 7.00 Years Bangalore,Churu, Cuttack, Anjaw, Tinsukia, Ghaziabad, Other Andhra Pradesh, Yamunanagar, Kavaratti, 29 Oct, 2024

ob description Process all reservation requests, changes, and cancellations received by phone, fax, or mail. Identify guest reservation needs and determine appropriate room type. Verify availabi...
hotel managementcustomer supporthotel bookingcommunication skillshotel operationshospitality managementhotel administration

Demand Generation Manager
SAIKOR SECURITY TRAINING AND SERVICES PRIVATE LIMITED 18.00 to 25.00 Years Bangalore,Noida, Chennai, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Delhi, Port Blair 29 Oct, 2024

We are looking for a Demand Generation Manager to develop and implement strategies to generate leads and revenue for the company. You will be responsible for working closely with the sales and m...
servicetelemarketinginsurancedigitalgoodappointmentsbusinesscrmdevelopmentcommunicationcustomersalesmarketingoutboundgenerationcallslife

Quality Control Manager
OVERNET TRADING PRIVATE LIMITED 24.00 to 25.00 Years Bangalore,Raipur, Vapi, Hyderabad, Gurugram, Mumbai City, Mahesana, Delhi, Vasco Da Gama, Khagaria 29 Oct, 2024

We are looking for a detail-oriented quality control manager to ensure the manufacturing production lines run smoothly and generate a consistently suitable output of products that meet quality an...
salestechgeneralqualityseniorprocurementcontrolequipmentproduction headsupervisoroperatorelectricalinstrumentmanager

Assistant Finance Manager
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 3.00 to 7.00 Years Bangalore,Noida, Chennai, Hyderabad, Gurugram, Pune, Mumbai City, Delhi 29 Oct, 2024

Job description

Developing an understanding of the strategies that drive our growth, you will be at the forefront of how we evolve to meet our goals. We have Finance Business Part...
payrollsupply chainprocurementrisk managementcustomer developmentforecastingfinancial reportinganalytical

Buyer (Commodity)
DOMNIC LEWIS PRIVATE LIMITED 3.00 to 7.00 Years Bangalore,Chennai 29 Oct, 2024

This role involves collaborating with global and regional teams to drive strategic purchasing initiatives and ensure the efficient, sustainable, and innovative management of the supply chain. Thi...
supplier managementcontractspurchaseindirectrenovationcontrolcapexcostconstructioncommodityglobal

Senior Sales Executive
HAPPY SQUARE OUTSOURCING SERVICES PRIVATE LIMITED 5.00 to 8.00 Years Bangalore 29 Oct, 2024

salesforwardingadministrationrevenue generation

Project Engineer
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 8.00 Years Bangalore,Chennai, Noida, Hyderabad, Gurugram, Pune, Mumbai City, Delhi 29 Oct, 2024

Prepare, schedule, coordinate, monitor, and control assigned engineering projects to ensure timely completion and quality delivery.

Monitor compliance with applica...
negotiationsite managementcivil engineeringengineeringleadershipsite executionautocadproject managementsite supervision

Marketing Manager
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 9.00 Years Bangalore,Chennai, Noida, Hyderabad, Gurugram, Pune, Mumbai City, Delhi 29 Oct, 2024

Develop and execute marketing strategies to enhance brand awareness and promote real estate projects effectively.

Analyze market trends, competitor activities, and...
product promotionbrand awarenesscommercial marketingcommunication skillsreal estate marketing

Bio-tech Research Associate / Scientist
NEW ERA LIFE CARE PRIVATE LIMITED 2.00 to 7.00 Years Bangalore,Iran, Zimbabwe, Mozambique, Jaipur, Iraq, Chennai, Noida, Hyderabad, Kolkata, Lebanon, Gur 29 Oct, 2024

We are looking for a Biologist to join our team and conduct research and experiments to gain a better understanding about different biological organisms in nature. Biol...
sciencebiochemical engineeringresearch analysisbioprocessingmicrobiologybiochemistryneurostimulationmicrobiological analysisbiologics

Test Automation Architect
UST Global 10.00 to 16.00 Years Bangalore,Chennai, Kochi, Noida, Hyderabad, Pune, Thiruvanananthapuram 29 Oct, 2024

Test Automation Architect Position Overview: We are seeking an experienced Test Automation Architect to design, develop, and maintain robust automation framewo...
pythonquality assurancejavaseleniumtosca

Agency Sales Manager
RELIANCE NIPPON LIFE INSURANCE COMPANY LIMITED 5.00 to 10.00 Years Bangalore,Other Maharashtra, Other Gujarat, Other Uttarakhand, Other West Bengal, Other Uttar Prades 29 Oct, 2024

Greetings from Reliance Nippon Life Insurance! We are excited to offer you a chance to advance your career with one of Indias Top 3 Most Trusted Life Insurance Service Brands, as recognized in t...
agency salesmotor insurancevehicleinsurancedirect channel salesinsurance sales

Direct Channel Sales
RELIANCE NIPPON LIFE INSURANCE COMPANY LIMITED 0.00 to 4.00 Years Bangalore,Mangalore, Guntur, Rajahmundry, Chennai, Hyderabad, Vijayawada, Vishakhapatnam, Amalapuram 29 Oct, 2024

Dear Candidate, Indias Best Life Insurance company is offering you senior sales roles with high salary package Best benefits package with on-role employment on company pay-rolls in your preferr...
agency salesvehiclemotor insurancedirect channel salesinsuranceinsurance saleswheeler

Salesforce CPQ - Lead (Wipro)
Wroots Global Private Limited 7.00 to 12.00 Years Bangalore,Noida, Chennai, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Delhi 29 Oct, 2024

Immediate Joiners or 30 Days Notice period is preferred.

Minimum 5 years of experience in Salesforce Sales & CPQ Cloud or any other CPQ Product salesforcelwccpq

Business Development Manager (Marketing Service Sales )
IMS people possible 2.00 to 6.00 Years Ahmedabad,Other Gujarat 29 Oct, 2024

Excellent Communication Skill Experience : 2 to 4 Years in Marketing Service Sales Market Research and Analysis: Conduct market research to identify potential business opportunities and trends....
Strategic PlanningClient Relationship ManagementNetworkingRisk ManagementSocial Media ManagementHootsuiteContent CreationExcellent Communication SkillMarket ResearchAnalysisSalesRevenue GenerationProposalPresentation DevelopmentNegotiation

Lead Generation
SetuBridge Technolabs 2.00 to 6.00 Years Ahmedabad,Other Gujarat 29 Oct, 2024

SetuBridge Technolabs is looking for a highly skilled and experienced Lead Generation Specialist to join our dynamic team. As a Lead Generation Specialist, you will play a crucial role in identify...
Microsoft Office SuiteSocial Media PlatformsMarketing ConceptsCustomer BehaviorOrganizational SkillsAnalytical MindsetPositive Attitude

Email Marketing Executive
Meru Accounting 1.00 to 5.00 Years Ahmedabad,Other Gujarat 29 Oct, 2024

We are seeking an experienced Email Marketing / Gmail Marketing Expert to join our team. The ideal candidate will have a proven track record of developing and executing successful email campaigns ...
Email MarketingCampaign DevelopmentContent DevelopmentMarketing AnalyticsGmail MarketingAB TestingList Management

Marketing Communications Executive
Triffid Marketing Private Limited 1.00 to 5.00 Years Ahmedabad,Other Gujarat 29 Oct, 2024

About Us: TRIFFID, is a global partner for all things marketing. Headquartered in India and catering to global clients, were not just a marketing agency were a brands growth champions. In a wor...
AdaptabilityExcellent Communication SkillsExperience in MarketingAdvertisingAnalytical Acumen

Property Consultant
079 spaces 0.00 to 4.00 Years Ahmedabad,Other Gujarat 29 Oct, 2024

URGENT OPENINGS FOR PROPERTY CONSULTANT WE ARE HIRING! ROLE DESCRIPTION The property consultant will be responsible for consulting clients, providing exceptional customer service, and driving s...
Customer serviceSalesStrong negotiationProblem solving abilities

React native developer
Techerudite 2.00 to 6.00 Years Ahmedabad,Other Gujarat 29 Oct, 2024

Work as part of a team to build React Native iOS / Android applications for FullStack clients. Build pixel-perfect, responsive UIs across both mobile platforms. Architect, build and maintain exc...
JavaScriptHTMLCSSUnit testingOOPS programmingREST APIs

Golang Developer - Ahmedabad
Vedlogic Solutions Pvt Ltd 3.00 to 7.00 Years Ahmedabad,Other Gujarat 29 Oct, 2024

Degree in Computer Science, Engineering, or a related field as well as prior experience as a Golang Developer You possess strong knowledge of common Goroutine and channel patterns You have exper...
dependency managementGitRESTful APIsdatabase systemstesting toolscommunication skillsGolang DeveloperGoroutineGo frameworksGo templating languagecode generation toolsteam player

Android Developer
GFL Recruitment Private Limited 3.00 to 7.00 Years Ahmedabad,Other Gujarat 29 Oct, 2024

Job Description Mobile Developer with strong Android development experience in Android studio. Requirements And Responsibilities Lead a small team of Android developers to develop our applicati...
Android developmentAndroid StudioRequirement AnalysisDesigningAndroid SDKJAVAAPIsDevelopingAndroid Enterprise applicationKotlinUI designing

Sales Executive ( Solar )
AIMHIGH HUMAN RESOURCES PRIVATE LIMITED 1.00 to 6.00 Years Ahmedabad,Navsari 29 Oct, 2024

Requirement: 1) Good Communication Skills. 2) Understanding about solar and its product. 3) have to travel out of city also....
lead generationsales

Drug Safety Associate
JAI AMBEY EMERGENCY SERVICES (I) PRIVATE LIMITED 2.00 to 7.00 Years Ahmedabad,Chennai, Kochi, Vishakhapatnam, Kolkata, Silchar, Tawang, Panna, Other Bihar, Other Karnat 29 Oct, 2024

Drug safety associate provides advice to case processing team in data entry of clinical trial SAEs into Argus safety database and to medical coding of adverse events and diseases according to Med...
pharmaceutical medicinemedical affairsclinical trialsdrug safetydrug accountabilitydrug regulatory affairsdrug monitoring

Assistant Sales Manager (BANCA)
ADITYA BIRLA SUN LIFE INSURANCE COMPANY LIMITED 0.00 to 3.00 Years Ahmedabad 29 Oct, 2024

Position: Assistant Sales Manager Department: TPD Banca Sales Job Summary: This position focuses on building and maintaining strong relations...
assistancebanca salessalesbancassurancelife insurance

Sales Support Associate
Atharv Vishnu Choudhari Hiring For R HUB 0.00 to 2.00 Years Ahmedabad 29 Oct, 2024

Job Description Location: Narol, Ahmedabad. Position: Executive Role:Sales and Marketing Qualification:Masters Experience: Fresher/ 1 years, Gender: Malepreferred. Spoken Language- G...
marketing managementclient onboardingbrand marketingb2b marketingsales coordinationsales support

Credit Manager Auto Loans
Taggd 2.00 to 7.00 Years Ahmedabad,Indore, Ranchi, Patna 29 Oct, 2024

Hiring Credit Manager and Area Credit Manager in Auto Loans/ Vehicle Loans Domain. All India opening. Locations Ranchi, Indore, Ahmedabad, Guwahati, Andhra Pradesh, Bihar. Duties & Resp...
vehicle loanscredit controlcredit analysiscredit risk

Layout Engineer
Talish Solutions 4.00 to 9.00 Years Ahmedabad 29 Oct, 2024

We have an opening for Layout Engineer our client in Kheda. Layout Engineer (Foundry) Position Title: Layout Engineer layoutfoundrydesigninspectionengineerdrowning

Assistant Manager Supply Chain (Social) for Cotton Industry
IMPACT CONSULTANTS 5.00 to 10.00 Years Ahmedabad,Rajkot, Aurangabad, Pune 29 Oct, 2024

A leading MNC Cotton company ishiring Asst. Manager Supply Chain (Social) Key Accountabilities:

The incumbent will help in implementing social conduc...
supply chaincomplianceginnersoraganic cotton

Fresher Required, B Com, BA, BCA, MCA, Bsc, Diploma
Amar Technolabs Private Limited 0.00 to 1.00 Years Ahmedabad 29 Oct, 2024

Looking to hire Fresh/Experienced For an Reputed IT Company in Ahmedabad for the post for, 1. Web/Graphics Designer 2. Tele Caller, BA, BDE, Office work, HR 3. Software tester, Web developer 4. ...
it trainingtrainingfreshersoftwereb.com

Billing Analyst
Divya Staffing Solution 0.00 to 4.00 Years Pune,Dehradun, Kolkata, Belgaum, Manali, Vasco Da Gama, Dibrugarh, Ahmedabad, Shimla, Guwahati 24 Oct, 2024

The billing analysts responsibilities include coordinating with other departments to ensure all sales and orders are accurately billed for, setting clients up for billing, issuing invoice Billin...
billinghealthcarepatient assessmentpatient care

Director of sales
TRAAB ENGINEERING INDIA PRIVATE LIMITED 15.00 to 25.00 Years Pune,Bangalore, Noida, Nellore, Vijayawada, Hyderabad, Kolkata, Gurugram, Mumbai City, Delhi 24 Oct, 2024

We arelooking forahigh-performing Sales Director. The successful candidate will meet our customer acquisition and revenue growth objectives. Sales director responsibilities include developing ke...
processcustomermanagementrevenuesalesbusinessdevelopmentplanaccountstrategiessatisfactiongrowth

PREV
NEXT

understanding of local language Job Openings

Accountant Responsibilities:

What does an office assistant do

Lease Administrator

Job description Developing an understanding of the strategies that drive our growth, you will be at the forefront of how we evolve to meet our goals. We have Finance Business Part... payrollsupply chainprocurementrisk managementcustomer developmentforecastingfinancial reportinganalytical

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Job description

Developing an understanding of the strategies that drive our growth, you will be at the forefront of how we evolve to meet our goals. We have Finance Business Part...
payrollsupply chainprocurementrisk managementcustomer developmentforecastingfinancial reportinganalytical