hireejobs
Register for Job
Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs
Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales
Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs
IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

presales consultant

Fresher   Bhubaneswar   24 Sep, 2025
BSH TECHNOLOGIES PRIVATE LIMITED
Job LocationBhubaneswar
EducationNot Mentioned
SalaryNot Disclosed
IndustryIT Services & Consulting
Functional AreaPre-Sales
EmploymentTypeFull-time

Job Description

    • Work closely with the Business Development & Sales teams to support lead qualification and opportunity conversion.
    • Conduct requirement gathering sessions with prospective clients and translate needs into tailored solutions.
    • Prepare and deliver compelling client presentations, demos, proposals, and estimations showcasing BSH Technologies offerings (Web, Mobile, Cloud, AI, Digital Transformation).
    • Collaborate with technical teams to create solution architectures, project estimations, and RFP responses.
    • Build and maintain a knowledge base of case studies, proposals, and solution templates.
    • Act as the technical liaison during client meetings to address queries and showcase domain expertise.
    • Track and report on presales activities and assist Sales with deal closures.

Keyskills :
crmpresentationsclientsmbsoftwaresalestoolsexcelpowerpointdemosmarketproposalsstrongmandatory.knowledgesystems.serviceslikeestimationsusing

APPLY NOW

presales consultant Related Jobs

© 2019 Hireejobs All Rights Reserved