ISM Digital Sales - IC role Customer Segment: SMB North America Location: Remote, India Note : Experience in end to end SAAS sales is mandatory, preferably in the SMB segment What Youl...
consultative sellingupsellinginbound salesaccount managementcommunication skillsinterpersonal skillsSAAS salescrosssellingsales methodologies

Role Overview: As a member of the Inside Sales team at Palo Alto Networks, you will play a crucial role in converting target small and medium businesses into customers. Your impact will involve ma...
SalesCustomer Relationship ManagementForecastingSalesforceMarketingChannel PartnersUpsellingAccount PlanningNegotiationCommunicationInformation TechnologyCrosssellingProduct Demos

Title:Manager - Data Science ( Credit Risk Domain Must) Company: PayU (India) Location: Bangalore/ Gurgaon/ Mumbai Who We Are: PayU is the fintech division of Naspers, a global internet and entert...
Data ScienceCredit RiskMachine LearningPythonSQLLogistic RegressionCatboost

Job Description (JD)

Hiring: Qual...

accounts payablequality analyst p2p quality analystap operationsprocure to payaccounts payable quality analyst

Marketing Lead (Lean Brand & PR MSME) Location: Mumbai, India Work Mode: In-Office We are looking for a high-impact, resourceful Marketing Lead to build brand presence and trust among the MSME...
marketingadsmeta

Role Overview: As a member of the Inside Sales team at Palo Alto Networks, you will play a crucial role in converting target small and medium businesses into customers. Your impact will involve ma...
SalesCustomer Relationship ManagementForecastingSalesforceMarketingChannel PartnersUpsellingAccount PlanningNegotiationCommunicationInformation TechnologyCrosssellingProduct Demos

Role Overview: Palo Alto Networks is seeking top performers to join their Inside Sales team to drive the next wave of success by converting small/medium businesses into customers. As a member of...
SalesCustomer Relationship ManagementForecastingSalesforceMarketingChannel PartnersUpsellingInformation TechnologyNegotiationCommunicationCrosssellingProduct Demos

As an Inside Sales Representative at AWS, you will play a crucial role in driving the companys fastest-growing SMB business in India. By joining our newly formed team, you will contribute to expan...
Inside SalesLead GenerationSaaSCommunication SkillsCloud IndustryIT IndustryEngagement SkillsCRM PlatformsSales Tools

As a Credit Underwriting & Operations Analyst at our company, you will play a crucial role within the Risk team by assisting in the day-to-day manual analysis of new customers on the platform. You...
Credit UnderwritingFinancial AnalysisData ReconciliationRisk ManagementFinancial Statement AnalysisCredit PoliciesInterpretation of Financial StatementsCommercial Credit ProductsCredit Risk Operations

As an Inside Sales Representative at Workmates, you will play a crucial role in driving net-new customer acquisition and revenue growth for AWS cloud services within the SMB and mid-market segment...
Managed ServicesGCPAzureInside SalesLead QualificationProposal SupportNegotiationPipeline ManagementOutbound SalesCommunication SkillsInterpersonal SkillsAWS Cloud ServicesSolution PositioningCustomer Needs AnalysisPresales CollaborationClo

Role Overview: As a member of the Inside Sales team at Palo Alto Networks, you will play a crucial role in converting small and medium businesses into customers by managing a large number of targe...
SalesCustomer Relationship ManagementForecastingSalesforceMarketingChannel PartnersUpsellingAccount PlanningNegotiationCrossselling

In the role of a Digital Media Solutions Manager at Google, you will be responsible for defining digital advertising strategies and marketing objectives for brand new customers to ensure immediate...
digital mediadigital marketingclient solutionsagreementspartnershipsrelationship managementadvertising solutionsdisplayvideo ecosystemGoogle Marketing Platformcustomer base managementbusiness recommendationsmultitasking

Marketing Lead (Lean Brand & PR MSME) Location: Mumbai, India Work Mode: In-Office We are looking for a high-impact, resourceful Marketing Lead to build brand presence and trust among the MSME...
marketingadsmeta

Role Overview: You are being hired as a Software Engineering Manager Cloud Services at Nasuni to lead the team responsible for building and operating cloud-native services that enhance the platfo...
PythonSecurityAWS cloud architectureAgile software developmentData pipelinesMachine learning workflowsInfrastructureascodeRansomware protectionData protection

As a B2B Sales and Digital Marketing Expert, your role will involve contacting new and existing clients via telephone, chat, and email to identify sales opportunities and provide the best solution...
B2B salesDigital MarketingAd salesCold callingMS Office

Leading Tech and software company requires Sr. Associate ( International sales) B2B - Remote ( The shift time is 7.30 pm- 4.30 am) One of our client a leading B2B enterprise software , AI and M...
international salesinside salesus salessaas sales

As a Cyber Incident Response Lead at Owens & Minor Halyard Health, you will be responsible for investigating and responding to cyber threats in the night shift (5:00 PM to 2:00 AM) based in India....
network traffic analysisSIEM log analysisEndpoint DetectionResponse EDRnetwork protocolsphishing investigationcredential theft investigationransomware investigationbotnets investigationdenial of service attacks investigationMITRE frameworkcyber

Leading Tech and software company requires Sr. Associate ( International sales) B2B - Remote ( The shift time is 7.30 pm- 4.30 am) One of our client a leading B2B enterprise software , AI and M...
international salesinside salesus salessaas sales

As a skilled and detail-oriented Storage Engineer with 5-7 years of experience, you will be responsible for managing and supporting enterprise storage infrastructures. Your expertise in Pure Stora...
StorageNetapp Storage

As a Software Engineer 2 at Dell Technologies, you will be part of the Software Engineering team responsible for delivering next-generation application enhancements and new products. You will work...
PythonSMBNFSSystem ConfigurationMemory ManagementNetwork Attached Storage NASSoftware Development LifecycleDistributed Software SystemsS3 InterfacesSystem CallsInterprocess IPCRemoteprocedure RPC CallsMultiplexed IO

As a member of Hidden Brains Infotech, your role will involve the following responsibilities and requirements: Role Overview: Hidden Brains Infotech is a CMMI Level 3 Enterprise Software Developm...
VeeAMNetBackupArcserveBackupRestoreNFSSMBDisaster RecoveryVirtual MachinesDatabasesAutomationTroubleshootingStorage ManagementReportsHYCUCommvaultQStar ASMSpectra Logic StackRP4VMNutanix DZertoCarboniteArchiveData Protection solutio

As a member of the India GTM team at Google, you will play a crucial role in supporting Googles India business across LCS. Your primary responsibility will be to work with product and specialist t...
management consultingsales operationsbusiness strategyinvestment bankingventure capitalcorporate advisoryproject managementinternet industrymedia industrytechnology industry

• Work closely with the Business Development & Sales teams to support lead qualification and opportunity conversion.
• Conduct r...
  crmpresentationsclientsmbsoftwaresalestoolsexcelpowerpointdemosmarketproposalsstrongmandatory.knowledgesystems.serviceslikeestimationsusing

As a skilled and detail-oriented Storage Engineer with 5-7 years of experience, you will be responsible for managing and supporting enterprise storage infrastructures. Your expertise in Pure Stora...
StorageNetapp Storage

About Us Prismberry is a leading provider of software & automation services to diverse industries. We specialize in Software Development and IT Services, with expertise in bespoke automation and ...
PythonDebuggingProgrammingMicrocontrollerMicroprocessorsFlaskJenkinsAWSAzureGCPKubernetesGITTesting frameworksRobot automation frameworkPyTestUnittestCICDDevOps principlesContainersVirtualization technologies

Location: Jaipur, India Salary 30000 - 60000 /month Job Type Full-time Date Posted October 28th, 2024 Apply Now We are seeking a driven and experienced Business Development Manager to joi...
Lead generationSales strategiesClient satisfactionSelling SaaS solutionsCRM toolsMarket demands

Role Description Job Overview: We are looking for a skilled and detail-oriented Storage Engineer with hands-on experience in managing and supporting enterprise storage infrastructures. The ideal...
StorageNetapp Storage

Job Title: Inbound Sales Manager (ISM) / Customer Success Manager (CSM) - Remote Company: Adobe Positions Available Inbound Sales Manager (ISM) Experience: Minimum 2 years of experience in B2B...
b2b salessaasinternational marketing

: Business Development Specialist SMB (R-17350) Location: Ljubljana - Slovenia Department: Sales Employee Type: Full Time business development strategies bb sales engagement customer relationship management consultative selling techniques sales cycle management proposal preparation business development specialist smb presentation b2b negotiation innovation market

Posted Date: 23 May 2022 Function/Business Area: Sales and Distribution Location: Mumbai Job Responsibilities: negotiation skillsanalytical skillscommunication skillsdealing ambiguity leadership skillssales cycle distribution account management saas selling