accordance of cgmp jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

accordance of cgmp Job Openings

Showing 51 - 100 of 3697 Jobs

Wanted Staff Nurse, DGNM, Midwifery

ACHIEVERS SPOT Hiring For Medical Coding 1.00 to 10.00 Years Hyderabad, GunturGuntur, Bangalore, Chennai, Nellore 31 Jul, 2026

Site Supervisor

AI MZ-Tech Consultant 1.00 to 10.00 Years Hyderabad, QatarQatar, Panaji, United Arab Emirates, Malaysia, South Goa, North Goa, Vasco Da Gama 31 Jul, 2026

Site Supervisor We are looking to employ a dedicated and experienced site supervisor to oversee construction projects and supervise the constructi...
sitecatalystsiterrasite supervisionsite managementsitemindersite integrationsite acquisitionsite engineeringsitecore

permit holder

TEAMPRO HR & IT SERVICES PRIVATE LIMITED 1.00 to 10.00 Years Hyderabad, BangaloreBangalore, Chennai, Noida, Gurugram, Kolkata, Pune, Mumbai City, Delhi, Oman 31 Jul, 2026

civil supervision

mechanical engineering

Rigging Supervisor

F Gheewala Human Resources Consultants 1.00 to 10.00 Years Gurugram, DelhiDelhi, Bangalore, Chennai, Kurnool, Rajahmundry, Nellore, Hyderabad, Kakinada, Punjab 31 Jul, 2026

Minimum 5 years of experience in Oil & Gas, Offshore, or Marine projects with a valid offshoresupervision

permit holder
TEAMPRO HR & IT SERVICES PRIVATE LIMITED 1.00 to 10.00 Years Gurugram, DelhiDelhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City, Oman 31 Jul, 2026

Qualification: Graduate (Civil & Mechanical) Project: Oil & Gas Employment Type: Permanent <...
civil supervisionmechanical engineering

Rigging Supervisor
F Gheewala Human Resources Consultants 1.00 to 10.00 Years Delhi, BangaloreBangalore, Chennai, Kurnool, Rajahmundry, Nellore, Hyderabad, Gurugram, Kakinada, Pu 31 Jul, 2026

RIGGER SUPERVISOR

Minimum 5 years of experience in Oil & Gas, Offshore, or Marine projects with a valid offshoresupervision

Field Collection Executive
AASAANJOBS PRIVATE LIMITED 1.00 to 10.00 Years Chennai, MaduraiMadurai, Theni, Coimbatore, Tamil Nadu 31 Jul, 2026

Position: Field Collections Executive
Location: Chennai (Multiple Locations) Interview Mode: Virtual Working Hours: ...
customer handlingbanking operationsnegotiation skillsfield collectionsfinancial servicesdra certifiedpayment recoveryloan collectionscollection executive

Rigging Supervisor
F Gheewala Human Resources Consultants 1.00 to 10.00 Years Bangalore, ChennaiChennai, Kurnool, Rajahmundry, Nellore, Hyderabad, Gurugram, Kakinada, Delhi, Punj 31 Jul, 2026

RIGGER SUPERVISOR

Minimum 5 years of experience in Oil & Gas, Offshore, or Marine projects with a valid offshoresupervision

Field Service Engineer
MEDI TRANSCARE PRIVATE LIMITED 1.00 to 10.00 Years Pune, Kozhikode 28 Jul, 2026

SUMMARY OF THE JOB The FSE is responsible for managing the customer support system in the installation, service and repair of all products supported by Client Company. Responsib...
installationcommunication skillsmedical equipmentfield service

ESG Manager
SOFT AND HARD SKILL DEVELOPMENT PRIVATE LIMITED 1.00 to 10.00 Years Pune, BangaloreBangalore, Chennai, Hyderabad, Ahmedabad 28 Jul, 2026

We are seeking an experienced ESG Manager to lead and strengthen our Environmental, Social, and Governance strategy across manufacturing operations. This is an excellent opportun...
audit compliancecarbon footprintenvironment managementwaste managementsustainability reportingapi manufacturing

US Retirement Services Testing 402g, ADP ACP Pune
WHITE HORSE MANPOWER CONSULTANCY (P) LTD 1.00 to 10.00 Years Pune 28 Jul, 2026

Job Description (JD)

US Retiremen...
compliance testing401k401402retirement operations402g testingdc plansdefined contribution plans

Liaison Officer
TRUE BUDDY CONSULTING PVT LTD 1.00 to 10.00 Years Noida, DelhiDelhi, Faridabad, Ghaziabad, Dharwad, Bellary, Gurugram 28 Jul, 2026

Job Description Executive Action & Liaison Location:PAN INDIA Experience: 1-5 Years Industry: Investigation / Risk Managemen...
due diligenceintelligence gatheringfield investigationsrisk managementgovernment liaison

Field Collection Executive
AASAANJOBS PRIVATE LIMITED 1.00 to 10.00 Years Madurai, CoimbatoreCoimbatore, Chennai, Tamil Nadu 28 Jul, 2026

Position: Field Collections Executive
Location: Chennai (Multiple Locations) Interview Mode: Virtual Working Hours: ...
financial servicescollectioncollectionsdrabanking collectioncertifiedbanking operationsdebt recoveryfield collectionsrecoveryloanpayment

Electrical Design Engineer
Jobsplan Dot Com 1.00 to 10.00 Years Mumbai City 28 Jul, 2026

Position: Project Design & Estimation (Electrical) Location: Mumbai Company- Engineering firm into pharmaceutical sector Duties and Res...
estimationelectrical designdesign

Ground Maintenance
AI MZ-Tech Consultant 1.00 to 10.00 Years Delhi, NoidaNoida, Bangalore, Chennai, Kurnool, Nellore, Hyderabad, Gurugram, Pune, Port Blair 28 Jul, 2026

GROUND MAINTENANCE T To keep estates well maintained by carrying out ground maintenance, grass and hedge cutting, de-weeding, on occasion you may be required to carry out other ...
grant monitoringgrangrant administrationgrant coordinationgraphic designinggrandparent rightsground staff activitiesgrand strategygrand openings

Field Collection Executive
AASAANJOBS PRIVATE LIMITED 1.00 to 10.00 Years Coimbatore, ChennaiChennai, Madurai, Tamil Nadu 28 Jul, 2026

Position: Field Collections Executive
Location: Chennai (Multiple Locations) Interview Mode: Virtual Working Hours: ...
financial servicescollectioncollectionsdrabanking collectioncertifiedbanking operationsdebt recoveryfield collectionsrecoveryloanpayment

Field Collection Executive
AASAANJOBS PRIVATE LIMITED 1.00 to 10.00 Years Coimbatore, ChennaiChennai, Tamil Nadu 28 Jul, 2026

Position: Field Collections Executive
Location: Chennai (Multiple Locations) Interview Mode: Virtual Working Hours: ...
debt recoverycustomer handlingbanking operationsnegotiation skillsfield collectionsbanking collectionfinancial servicesloan collectionscollection executive

Hiring For Agency Development Manager Top Insurance salary upto 4 lac
Niyukti Management Consultants 1.00 to 10.00 Years Chandigarh, MohaliMohali, Ludhiana, Panchkula, Jalandhar, Bulandshahr, Bathinda, Patiala, Amritsar 28 Jul, 2026

life Insurance Post- Sales Manager, Salary- 4 lac Rimb Incentive Exp.3 To 14 In sales The Key Responsibilities of the Incumbent:

To identify potential insurance advisors and recrui...
salesinsurance salesarea sales managerterritory sales managerrelationship managerdevelopment managerbusiness managersales officeragency manager

ESG Manager
SOFT AND HARD SKILL DEVELOPMENT PRIVATE LIMITED 1.00 to 10.00 Years Chennai, BangaloreBangalore, Hyderabad, Pune, Ahmedabad 28 Jul, 2026

We are seeking an experienced ESG Manager to lead and strengthen our Environmental, Social, and Governance strategy across manufacturing operations. This is an excellent opportun...
audit compliancecarbon footprintenvironment managementwaste managementsustainability reportingapi manufacturing

Business process executive
FW FUTURESWINGS PRODUCTS & SERVICES (OPC) PRIVATE LIMITED 1.00 to 10.00 Years Bangalore, PurniaPurnia, Ongole, Chennai, Nellore, Ghaziabad, Hyderabad, Kolkata, Gurugram, Chittoor 28 Jul, 2026

Process executives manage all business processes of an organization. They take care of the companys objectives and expansion initiatives. Process executives ensure all queries are addressed, and ...
teamworkcommunicationmanagementtimethinkingproblem-solvingcritical

Hiring For Agency Development Manager Insurance Good salary
Niyukti Management Consultants 1.00 to 10.00 Years Agra, DelhiDelhi, Bulandshahr, Saharanpur, Meerut, Moradabad, Dehradun, Gurugram, Alwar, Ajmer 28 Jul, 2026

life Insurance Post- Sales Manager, Salary- 4 lac Rimb Incentive Exp.3 To 14 In sales The Key Responsibilities of the Incumbent:

To identify potential insurance advisors and recrui...
insurance salessalessales managerarea sales manageragency managerrelationship managerdevelopment managersales officerterritory sales manager

ESG Manager
SOFT AND HARD SKILL DEVELOPMENT PRIVATE LIMITED 1.00 to 10.00 Years Ahmedabad, BangaloreBangalore, Chennai, Hyderabad, Pune 28 Jul, 2026

We are seeking an experienced ESG Manager to lead and strengthen our Environmental, Social, and Governance strategy across manufacturing operations. This is an excellent opportun...
audit compliancecarbon footprintenvironment managementwaste managementsustainability reportingapi manufacturing

Planner Operations
AYURSMITH WELLNESS (OPC) PRIVATE LIMITED 1.00 to 10.00 Years Vijayawada, KakinadaKakinada, Nellore, Kurnool, Oman, Qatar, Saudi Arabia, Kuwait, Bangalore, Philip 22 Jul, 2026

Production Planner Job Description Template We are looking to employ a detail-oriented and experienced production planner to create, modify, an...
gismanagementpurchaseclientanalyticalmrpdodlogisticsservicecustomerinterpersonalexcellentstrongexceptionalorders

NDE Technician
UNInternational 1.00 to 10.00 Years Vishakhapatnam, HyderabadHyderabad, Chennai, Kolkata, Jamshedpur, Jharkhand, Bihar, Patna, Muzzafarp 22 Jul, 2026

The UT Technician will perform Ultrasonic Testing (UT) on cast and forged components to detect internal discontinuities, ensuring full compliance with client specification, internal quality proce...

Local Product Manager - Instrument Transformer
Hitachi Careers 1.00 to 10.00 Years Vadodara 22 Jul, 2026

Position Summary The Local Product Manager is responsible for managing the product portfolio at the local manufacturing site, ensuring alignment between market requirements, customer expectatio...
Product ManagementMarketingEngineeringStakeholder ManagementMarket AnalysisStrategic PlanningCommunicationPresentationInstrument Transformer

Desktop Support Engineer L1
Lauren Information Technologies Pvt Ltd 1.00 to 10.00 Years Vadodara 22 Jul, 2026

Activities: Primary skills: Call Logging, Customer Engagement, Computer Network, Accepts Responsibility, Commitment, Assembling, Call Quality Measurement, Asset Management, Ability to Handle, Com...
Call LoggingCustomer EngagementAssemblingAsset ManagementCommunicationComputer NetworkAccepts ResponsibilityCommitmentCall Quality Measurement

Plant Safety Manager
TALENTCO HR SERVICES LLP 1.00 to 10.00 Years Navi Mumbai, Mumbai City 22 Jul, 2026

Job Title: Plant Safety Manager
Job Description
The Plant Safety...
risksafetyemergencyhseinvestigationhealthmanufacturingauditassessmentehsindustrialaccidentplantoccupationalmanager

Purchase Executive
ETHOS HR MANAGEMENT AND PROJECTS LIMITED 1.00 to 10.00 Years Mumbai City 22 Jul, 2026

Responsibility such as 1. Creating a purchase budget 2. Stock as per minimum inventory level (Regular, Critical) 3. Vendor Development / Vendor assessment 4. To ensure cost reduction based o...
purchase vendor developmentpurchase processpurchase operationspurchase order

Hiring Business Development Manager Top Insurance Good salary
Niyukti Management Consultants 1.00 to 10.00 Years Lucknow, KanpurKanpur, Varanasi, Allahabad, Delhi, Meerut, Bhubaneswar, Kolkata, Gangtok, Guwahati 22 Jul, 2026

life Insurance Post- Sales Manager, Salary- 4 lac Rimb Incentive Exp.3 To 14 In sales The Key Responsibilities of the Incumbent:

To identify potential insurance advisors and recrui...
insurance salessalesbusiness managerdevelopment managersales managerarea sales managerterritory sales manageragency managersales officer

Offshore vacancy Required ( Rigger )
Apex Offshore Service 1.00 to 10.00 Years Idukki, KannurKannur, Kollam, Palakkad, Thrissur, Bellary, Karnal, Jamshedpur, Kakinada, Anantpur 22 Jul, 2026

Greeting We are hiring for the position of RIGGERwith a leading Oil & Gas Industry Job Responsibility:

Performs rigging wo...
offshore platformsoffshoreriggersrigplatformrigs

Wanted B pharm Fresher For Medical Coding
ISKILLS SOLUTIONS 1.00 to 10.00 Years Chennai, VelloreVellore, Viluppuram, Tiruchengode, Thoothukudi, Salem, Nagercoil, Dindigul, Neyveli, 22 Jul, 2026

Role- Medical Coder: We are looking to hire an fresher Coder (B Pharm, Microbiology, Biology etc.)With strong domain expertise in CPT and ICD (diagnosis) coding, the incumbent should be able to v...
radiologycardiologyanesthesianursingdialysisbiologyzoologybiochemistry

Audit and Assurance - Qualified CA
JCSS CONSULTING PVT LTD 1.00 to 10.00 Years Bangalore 22 Jul, 2026

Position Associate / Senior Associate / Assistant Manager Audit and Assurance

Qualification Chartered Accountant
...
assuranceauditifrsstatutory auditindian accounting standards

Appian Developer
Wroots Global Private Limited 1.00 to 10.00 Years Bangalore 22 Jul, 2026

Job Description Raytheon Technologies (RTX) has an opening for an Automations Developer (Manager, Business Systems and Transformation) to join the Enterprise Intelligent ...
migrationsailbpmflowapplicationprocessenterpriseappianautomationdesignrulesworkrecorddecisiontypes

Junior Officer
Cadila Pharmaceuticals Ltd 1.00 to 10.00 Years Ahmedabad, Gurugram 22 Jul, 2026

To maintain and adherence of the GLP and safety procedures in laboratory. To perform the analysis as per work allocation and records the results in work sheet (Protocols) for raw material / packi...
Pharmacology

NDE Technician
UNInternational 1.00 to 10.00 Years Ahmedabad, AssamAssam, Chennai, Hyderabad, Kolkata, Vishakhapatnam, Jamshedpur, Jharkhand, Bihar, Gu 22 Jul, 2026

Operate Linac and associated RT equipment in accordance with manufacturer operating manual, approved procedures and NRRC & TCF EHSS regulatory requirem...
tcfapi testingastmasmenrrc

AGM - Downstream Processing
Cadila Pharmaceuticals Ltd 1.00 to 10.00 Years Ahmedabad 22 Jul, 2026

Role Overview Department: DSP Designation: AGM Reporting To: General Manager Principal Tasks and Responsibilities Lead and supervise the downstream processi...
hplcanalytical developmentdownstream processing

Software Engineering Leader
Mastercard India Services Pvt Ltd 1.00 to 10.00 Years All India, Pune 20 Jul, 2026

Role Overview: As a Software Engineering leader in Corporate Solutions at Mastercard, you will manage teams that operate in modern full-stack development practices and tools to create world-class ...
JavaSpring Boot application developmentData EngineeringData WarehousingETLData pipeliningTypescriptAngularFrontend developmentCloudbased developmentdeliveryResiliencybased patternspracticesService DevelopmentIntegrationEventCommand Messaging

Strategy & Operations Manager
Jobrapido 1.00 to 10.00 Years Thiruvananthapuram 20 Jul, 2026

About Revolut People deserve more from their money. More visibility, more control, and more freedom. Since 2015, Revolut has been on a mission to deliver just that. Our powerhouse of products i...
codingSQLPythondata analysisstrategic planningsupply chain managementvendor management

Senior Operations Manager - Customer Experience Quality Operations
Amazon India Limited 1.00 to 10.00 Years Noida 20 Jul, 2026

Sr. Operations Manager, CXQO As part of the AWS Applied AI Solutions organization, we have a vision to provide business applications, leveraging Amazons unique experience and expertise, that are u...
Operations ManagementPeople ManagementProject ManagementCoachingPerformance ManagementTalent DevelopmentAnalytical SkillsSix SigmaStrategic Relationship Building

AML Operations Analyst AML Quality Control (AML QC)
Gratitude Inc 1.00 to 10.00 Years Chennai 20 Jul, 2026

AML Operations Analyst AML Quality Control (AML QC) | Bangalore / Chennai | Up to 12.5 LPA Location: Bangalore or Chennai Experience: 10 Years Salary: Up to 12.5 LPA Band: BPO 3/4 Hiring: Immedi...
Transaction MonitoringRisk AssessmentRegulatory ComplianceDocumentationReport WritingAML OperationsFinancial Crime ComplianceAML Quality ControlFCRM systems

Cyber Security Operations Analyst
Cybage 1.00 to 10.00 Years Mumbai City 20 Jul, 2026

Department Engineering Location Pune Work Experience 6years About The Position The Senior Security Operations Analyst will be responsible for monitoring security alerts, in...
Security OperationsSOCInfrastructure SecurityEnterprise Security SupportCrowdStrike EDRCrowdStrike NextGen SIEMZscalerForescout NACDLP Solutions

HR Admin Executive
Indobricks Real Estate Advisory Private Limited 1.00 to 10.00 Years Thane 20 Jul, 2026

Qualification: MBA in HR (2-5 years Real estate relevant experience) The ideal candidate should have an ability to manage the organization, bring in ideas and processes to better the functionality...
BudgetingPlanningPerformance AppraisalHR OperationsLeadershipCommunicationInterpersonal SkillsManagerial SkillsProblemSolving

Manager, Clinical Data Scientist, Cdis (Tamil Nadu)
Pfizer 1.00 to 10.00 Years All India 20 Jul, 2026

ROLE SUMMARY As part of the Clinical Data Sciences CDS group an integral delivery unit within the Clinical Development Operations CD O organization the Clinical Data Scientist CDS is responsible f...
Clinical Data ManagementClinical TrialsQuery ManagementElectronic Data CaptureData Acquisition StandardsData Management PlanQuality Risk IndicatorsData ReviewData Set Release

Manager, Clinical Data Scientist
1G5 Pfizer Healthcare India Private Limited 1.00 to 10.00 Years Chennai 20 Jul, 2026

As part of the Clinical Data and Information Sciences (CDIS)group, an integral delivery unit within the Clinical Development & Operations (CD&O)organization, the Clinical Data Scientist is respons...
Data ManagementData StandardsSOPsClinical Data ScientistCDISQuality Risk IndicatorsData Acquisition StandardsClinical Trial DataGCDMPs

Manager, Data Science
Mastercard 1.00 to 10.00 Years Pune 20 Jul, 2026

Our Purpose Mastercard powers economies and empowers people in 200 countries and territories worldwide. Together with our customers, were helping build a sustainable economy where everyone can pr...
Data ScienceLeadershipProject ManagementBusiness StrategyData AnalysisMachine LearningModel DevelopmentData EngineeringAnalytics

Planner Operations
AYURSMITH WELLNESS (OPC) PRIVATE LIMITED 1.00 to 10.00 Years Vijayawada, KakinadaKakinada, Nellore, Kurnool, Oman, Qatar, Saudi Arabia, Kuwait, Bangalore, Philip 17 Jul, 2026

Production Planner Job Description Template We are looking to employ a detail-oriented and experienced production planner to create, modify, an...
gismanagementpurchaseclientanalyticalmrpdodlogisticsservicecustomerinterpersonalexcellentstrongexceptionalorders

NDE Technician
UNInternational 1.00 to 10.00 Years Patna, KolkataKolkata, Muzzafarpur, Bihar, Chennai, Hyderabad, Vishakhapatnam, Jamshedpur, Jharkhand 17 Jul, 2026

The UT Technician will perform Ultrasonic Testing (UT) on cast and forged components to detect internal discontinuities, ensuring full compliance with client specification, internal quality proce...

Hiring For Agency Development Manager Top Insurance salary upto 4 lac
Niyukti Management Consultants 1.00 to 10.00 Years Mohali, ChandigarhChandigarh, Panchkula, Ludhiana, Amritsar, Delhi, Bathinda, Patiala, Moga, Jalandh 17 Jul, 2026

life Insurance Post- Sales Manager, Salary- 4 lac Rimb Incentive Exp.3 To 14 In sales The Key Responsibilities of the Incumbent:

To identify potential insurance advisors and recrui...
salesinsurance salesdevelopment managerterritory sales managerarea sales manageragency managerbusiness managerrelationship managersales manager

Solar Site Supervisor
DIGYUG LLP 1.00 to 10.00 Years Mumbai City, Thane 17 Jul, 2026

The Solar Site Supervisor is responsible for the on-site supervision, execution, and monitoring of solar photovoltaic (PV) installation projects and Operations & Maintenance (O&M) activities. The...
site installationsafetylt panelssite supervisionsopsoperationssolar systemsmaintenancesolar pv

Freelance recruiter / Homebased
QRN Services Hiring For None 1.00 to 10.00 Years Mumbai City, BangaloreBangalore, Chennai, Hyderabad, Gurugram, Delhi 17 Jul, 2026

NEED urgently freelancer recruiters, FRESHERS ELIGIBLE, Good communication skills in english and quick learner . Interested candidates dont apply online or send resumes contact: QRN Ser...
recruitmentcommunication skillsfreelanceplacementhiringvacanciescustomer relationshomebased

PREV
NEXT

accordance of cgmp Job Openings

Site Supervisor We are looking to employ a dedicated and experienced site supervisor to oversee construction projects and supervise the constructi... sitecatalystsiterrasite supervisionsite managementsitemindersite integrationsite acquisitionsite engineeringsitecore

Position: Field Collections Executive

Job Description (JD)

US Retiremen... compliance testing401k401402retirement operations402g testingdc plansdefined contribution plans

Position: Field Collections Executive

Position: Field Collections Executive

Position: Field Collections Executive

Production Planner Job Description Template We are looking to employ a detail-oriented and experienced production planner to create, modify, an... gismanagementpurchaseclientanalyticalmrpdodlogisticsservicecustomerinterpersonalexcellentstrongexceptionalorders

Job Description

Production Planner Job Description Template We are looking to employ a detail-oriented and experienced production planner to create, modify, an... gismanagementpurchaseclientanalyticalmrpdodlogisticsservicecustomerinterpersonalexcellentstrongexceptionalorders

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Site Supervisor We are looking to employ a dedicated and experienced site supervisor to oversee construction projects and supervise the constructi...
sitecatalystsiterrasite supervisionsite managementsitemindersite integrationsite acquisitionsite engineeringsitecore

US Retiremen...
compliance testing401k401402retirement operations402g testingdc plansdefined contribution plans

Production Planner Job Description Template We are looking to employ a detail-oriented and experienced production planner to create, modify, an...
gismanagementpurchaseclientanalyticalmrpdodlogisticsservicecustomerinterpersonalexcellentstrongexceptionalorders

Production Planner Job Description Template We are looking to employ a detail-oriented and experienced production planner to create, modify, an...
gismanagementpurchaseclientanalyticalmrpdodlogisticsservicecustomerinterpersonalexcellentstrongexceptionalorders