aienabled tools jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

aienabled tools Job Openings

Showing 25801 - 25850 of 31022 Jobs

Embedded/Linux Engineer - C/C Programming

MLOPS Solutions Private Limited 5.00 to 8.00 Years Pune 01 Apr, 2024

embedded software development

objectoriented programming

Network Architect

Calsoft 2.00 to 6.00 Years Pune 01 Apr, 2024

CiscoArubaArista Data Center

Campus Switching

routing

Routing protocols eg OSPF

Switching technologies eg Stacking

VPC

MLAG

NMSNetw

Lead Firmware Engineer

Right Advisors Private Limited 8.00 to 12.00 Years Pune 01 Apr, 2024

Communication Protocols

Wireless Technologies

Debugging

Communication Skills

Problemsolving

Principal Verification Engineer

Marvell India 5.00 to 15.00 Years Pune 01 Apr, 2024

Hardwaere Engineer

Electronica HiTech Machine Tools Pvt Ltd 3.00 to 6.00 Years Pune 01 Apr, 2024

wiring diagrams

Bill of material

hardware electronics design

DC drive system

Schematic entry in OrCAD

PCB layout design

Control panel designfabrication knowledge

Testing

implementation of designs

Marketing Manager

MILLENNIUM BABYCARES PRIVATE LIMITED 13.00 to 23.00 Years Pune 01 Apr, 2024

Sr Engineer - NFVI Servers & Virtualization Layer-VNF

Tata Communications 4.00 to 8.00 Years Pune 01 Apr, 2024

Virtualization technologies

VNF management

Problemsolving

Network protocols

Consultant - Azure Service bus

LTIMindtree Limited 3.00 to 8.00 Years Pune 01 Apr, 2024

Roles & Responsibilities: -

azure

asp.net

.net

Junior Accountant

PETAGMA PRIVATE LIMITED 1.00 to 0.00 Years Nagpur 01 Apr, 2024

Angular Developer

Raisoni Group Of Institution 3.00 to 7.00 Years Nagpur 01 Apr, 2024

Business Analytics (Marketing) Internship in Nagpur (Hybrid)

Think Of It Foundation 0.00 to 4.00 Years Nagpur 01 Apr, 2024

Email Campaign Metrics

Competitive Research

Marketing Tools

Sales

Web Developer

SEAES 2.00 to 6.00 Years Nagpur 01 Apr, 2024

Web Development

Programming

Web Design

BackEnd Web Development

Network Support Analyst

NTT DATA Services 3.00 to 5.00 Years Noida 01 Apr, 2024

Graphic Designer (Figma)

InCraftiv Pvt Ltd 0.00 to 2.00 Years Noida 01 Apr, 2024

IT Hardware Sales Specialist

UTL Homes PvtLtd 1.00 to 0.00 Years Noida 01 Apr, 2024

IT hardware technologies

CRM software

sales tracking

problemsolving

Maintenance Engineer

KINAL GLOBAL CARE PRIVATE LIMITED 15.00 to 25.00 Years Noida 01 Apr, 2024

Job description

bachelors degree in engineering preferably in Mechanical, Electrical or Instrumentation with CGPA 7.0 or above;

Minimum 8 years of experience in oil and ga...
maximoschedulingmaterial managementpackaginghydraulicsinstrumentationorder managementms projectutility maintenance

Maintenance Engineer

KINAL GLOBAL CARE PRIVATE LIMITED 2.00 to 7.00 Years Noida 01 Apr, 2024

Job description

bachelors degree in engineering preferably in Mechanical, Electrical or Instrumentation with CGPA 7.0 or above;

Minimum 8 years of experience in oil and ga...
hydraulicsms projectmaximomaterial managementschedulingorder managementpackagingplant maintenanceinstrumentation

Electronic Technician

MILLENNIUM BABYCARES PRIVATE LIMITED 3.00 to 8.00 Years Noida 01 Apr, 2024

component repair

automobile engineering

electrical contracting

electrical maintenance

analytical research

supervisory management

electrical estimating

maintenance inspections

technical sales

Operations Manager

BETTER HIRE 2.00 to 4.00 Years Mangalore 01 Apr, 2024

A Operations Manager isresponsible for the entire operation of a branch; from ensuring the attainment of sales goals to overseeing everyone provides excellent customer service. Branch ope...
operations team handlingoperational excellenceoperations management

Quality Assurance Auditor
Lakshman Kumar Hiring For Lakshman Enterprise 1.00 to 6.00 Years Mangalore 01 Apr, 2024

We are looking for a detail-oriented quality assurance specialist to be in charge of all quality assurance activities. Responsibilities Preparing and implementing quality assurance policies and...
quality auditingquality controlquality assurance

Civil Technician
MILLENNIUM BABYCARES PRIVATE LIMITED 10.00 to 14.00 Years Mumbai City 01 Apr, 2024

Civil technicians, also known as civil engineering technicians, contribute to infrastructure projects such as highway construction and bridge building by providing direct support to civil enginee...
toolsengineeringgeotechnical engineeringdesignwallstransportation engineeringdatacollectionenvironmental engineeringasphaltcivilmanagementretainingprojecthand

Quality Analyst
The HR Gallery 2.00 to 4.00 Years Mumbai City 01 Apr, 2024

The Internal Quality Auditor ensures that department processes and the goods and services that result comply with the requirements of standards, as well as customer, regulatory, and the organi...
quality auditcall qualitycall auditauditing

CNC Lathe Machine Operator
Innomation 2.00 to 5.00 Years Hyderabad 01 Apr, 2024

Job Description Posted on: March 12, 2022 Vacancy: 1 Work Experience: 2 to 5 years in a similar job profile Educational Qualification: ITI/Diploma in Mechanical/Manufacturing or B. Voc (Level ...
communication skillsCNC operatoroperating CNC machineryprecision measurement toolsreading mechanical documentsinterpreting mechanical drawingsmechanical aptitudemath skills

Maintenance Engineer
KINAL GLOBAL CARE PRIVATE LIMITED 15.00 to 25.00 Years Hyderabad 01 Apr, 2024

Job description

bachelors degree in engineering preferably in Mechanical, Electrical or Instrumentation with CGPA 7.0 or above;

Minimum 8 years of experience in oil and ga...
maximoschedulingmaterial managementpackaginghydraulicsinstrumentationorder managementms projectutility maintenance

Maintenance Engineer
KINAL GLOBAL CARE PRIVATE LIMITED 2.00 to 7.00 Years Hyderabad 01 Apr, 2024

Job description

bachelors degree in engineering preferably in Mechanical, Electrical or Instrumentation with CGPA 7.0 or above;

Minimum 8 years of experience in oil and ga...
hydraulicsms projectmaximomaterial managementschedulingorder managementpackagingplant maintenanceinstrumentation

Area Sales Manager - Telangana
HARMAN International 8.00 to 10.00 Years Hyderabad 01 Apr, 2024

About The Role The person will be responsible for end-to-end General Trade business of the defined territory. The person will be responsible for Implementing the overall Strategic sales plan, tar...
SalesBusiness DevelopmentStrategic PartnershipsRelationship ManagementMarket AnalysisProject ManagementRetail Sales StrategiesCustomer LiaisonMarket Feedback

PHP Developer
NEUMERIC TECHNOLOGIES PVT LTD 3.00 to 8.00 Years Hyderabad 01 Apr, 2024

Title:PHP Developer Job Type: Full Time Location: Dilsukhnagar/Gachibowli, TS Experience: 3-8 years Key Responsibil...
mysqlmvcjavascriptdrupalphpwordpressgitnosqlhtml5

UX/UI Designer
NEUMERIC TECHNOLOGIES PVT LTD 3.00 to 8.00 Years Hyderabad 01 Apr, 2024

Title:UX/UI Designer Job Type: Full Time Location: Dilsukhnagar/Gachibowli, TS Experience: 3-8 years Key Responsibilities: Key Respons...
mobile interfacesdrupalux designmobile web designdotnetnukeweb designingcss3html5

Civil Technician
MILLENNIUM BABYCARES PRIVATE LIMITED 10.00 to 14.00 Years Hyderabad 01 Apr, 2024

Civil technicians, also known as civil engineering technicians, contribute to infrastructure projects such as highway construction and bridge building by providing direct support to civil enginee...
toolsengineeringgeotechnical engineeringdesignwallstransportation engineeringdatacollectionenvironmental engineeringasphaltcivilmanagementretainingprojecthand

Telemarketer
Narediin 4.00 to 8.00 Years Delhi 01 Apr, 2024

Company Description Naredi.in is a new age business based in New Delhi. The company aims to provide the best products for automotive tools without delay, sourcing global products to benefit busin...
interpersonal skillscommunicationcustomer servicesalesMS Officecomputer operatingtelemarketingreportingplanningschedulingpower toolsEnglish proficiencysocial messengersfollow upautomotive toolsbattery chargersjump starters

Maintenance Engineer
KINAL GLOBAL CARE PRIVATE LIMITED 15.00 to 25.00 Years Ghaziabad 01 Apr, 2024

Job description

bachelors degree in engineering preferably in Mechanical, Electrical or Instrumentation with CGPA 7.0 or above;

Minimum 8 years of experience in oil and ga...
maximoschedulingmaterial managementpackaginghydraulicsinstrumentationorder managementms projectutility maintenance

Maintenance Engineer
KINAL GLOBAL CARE PRIVATE LIMITED 2.00 to 7.00 Years Ghaziabad 01 Apr, 2024

Job description

bachelors degree in engineering preferably in Mechanical, Electrical or Instrumentation with CGPA 7.0 or above;

Minimum 8 years of experience in oil and ga...
hydraulicsms projectmaximomaterial managementschedulingorder managementpackagingplant maintenanceinstrumentation

Ethics and Compliance Analyst
WSP 1.00 to 3.00 Years Noida 01 Apr, 2024

Role Summary The Ethics & Compliance Specialist (ECS) will be part of the Ethics & Compliance team at WSP. The role will be located in WSP India. The ECS will be supporting the Ethics and Complia...
Quality AssuranceLegalProcurementAuditRiskOffice 365MS OutlookMS WordMS AccessMS ExcelAnalytical SkillsCritical ThinkingTime ManagementInterpersonal SkillsCommunication SkillsCultural AwarenessODBCEthicsComplianceWritten ReportsResearch

Sales & Marketing Manager
1.00 to 6.00 Years Delhi 01 Apr, 2024

Company Overview: Patronus Marketing Management is a 360-degree marketing agency founded by individuals who recognized the need for fresh and distinct marketing strategies in todays competitive m...
salessellingsales process

Senior itinerary designer
Bling Bird Travelhouse 3.00 to 7.00 Years Delhi 01 Apr, 2024

Company Description A new-age luxury travel brand that proposes to bring a whole new meaning to travel and give privileged travelers an opportunity to invest in experiences. Bling Bird Travelhous...
Travel PlanningTime ManagementCommunication SkillsInterpersonal SkillsItinerary DesignOrganizational SkillsClient PreferencesTravel Booking Platforms

International Travel sales
CAREER MISSION 1.00 to 5.00 Years Gurugram 01 Apr, 2024

Position Title: International Travel Sales Experience- 6months Location- Gurugram Salary- 37k 15k incentive We are seeking a dynamic and results-oriented International Travel Sales Consultan...
travelsales

Assistant Front Office Manager
Concept Hospitality 2.00 to 6.00 Years Delhi 01 Apr, 2024

The Assistant Front Office Manager Acting Head of Department (HOD) assumes a leadership role , overseeing daily operations at the front desk. Responsibilities include managing staff, ensuring smoo...
Interpersonal skillsExcellent communicationOrganizational skillsMultitasking abilities

Customer Care Representative
BHARTI HR CLEANER WALA ZEEVIKA JOBS Hiring For Optistaff Solution Private Limited 0.00 to 4.00 Years Panchkula 01 Apr, 2024

The Customer Care Representative plays a crucial role in providing exceptional customer service and support to clients or customers of the organization. They serve as the primary point of contact...
customer relationshipcustomer carecustomer service managementcustomer supportcustomer service delivery

Concrete finisher
ENVICARE TECHNOLOGIES PRIVATE LIMITED 20.00 to 25.00 Years Chennai 01 Apr, 2024

Carrying out correct and accurate measurements to ensure that concrete meet blueprint specs

Reading blueprints and examining drawings to ensure that they are correct and to als...
generalconcretefinisher

Brick mason
ENVICARE TECHNOLOGIES PRIVATE LIMITED 20.00 to 25.00 Years Chennai 01 Apr, 2024

Examining and studying layouts and preparing surfaces before working

Identifying and analyzing the width and length of the area and coming up with a design plan for constructio...
general brick masonassistant brick mason

3D Visualizer
Shilpa Architects Planners Designers 1.00 to 5.00 Years Chennai 01 Apr, 2024

Architectural Visualizer (Junior - Mid level) About Us: Shilpa Architect is a dynamic and innovative architecture firm known for its commitment to design excellence and sustainable solutions. Wi...
3D ModelingRenderingCollaborationAutoCADSketchUp3ds MaxRevitVRayLumionAdobe PhotoshopAfter EffectsTexturingLightingPostProductionDeadline ManagementContinual Learning

Specialist, Contact Centre, Consumer Banking
DBS Bank 5.00 to 8.00 Years Chennai 01 Apr, 2024

Business Function Group Technology and Operations (T&O) enables and empowers the bank with an efficient, nimble and resilient infrastructure through a strategic focus on productivity, quality & c...
Quality ManagementTrainingCustomer ServiceBanking OperationsTeam ManagementProcess ImprovementMS Office ToolsRiskCompliance

Team Lead, Technology, Project Management, Corporate Banking; Lead...
DBS Bank 8.00 to 12.00 Years Chennai 01 Apr, 2024

Business Function Technology and Operations (T&O) enables and empowers the bank with an efficient, nimble and resilient infrastructure through a strategic focus on productivity, quality & control...
Architectural DesignMonitoringLoggingTracingAutomated TestingData ManagementJIRALeadershipCommunicationCollaborationJavaPythonJavaScriptDevOpsAutomationJenkinsSite Reliability EngineeringSRECICDObservabilityAlertingCloud Platforms

Civil Technician
MILLENNIUM BABYCARES PRIVATE LIMITED 10.00 to 14.00 Years Chennai 01 Apr, 2024

Civil technicians, also known as civil engineering technicians, contribute to infrastructure projects such as highway construction and bridge building by providing direct support to civil enginee...
toolsengineeringgeotechnical engineeringdesignwallstransportation engineeringdatacollectionenvironmental engineeringasphaltcivilmanagementretainingprojecthand

Branch Operations Manager
BETTER HIRE 6.00 to 7.00 Years Chennai 01 Apr, 2024

A Branch Operations Manager isresponsible for the entire operation of a branch; from ensuring the attainment of sales goals to overseeing everyone provides excellent customer service. Bra...
business planningoperations team handlingoperations managementoperating systemsoperational excellence

Data Analyst (Power BI, Python, SQL)- Internal Audit domain, Bangalore
Talent Leads HR Solutions Pvt Ltd 3.00 to 8.00 Years Bangalore 01 Apr, 2024

Qualification- Mba Finance / Mca Experience 3 years Location Bangalore BO. 5.5 Days working from Office Key responsib...
sqlpowerdata analysisdatapython

Maintenance Engineer
KINAL GLOBAL CARE PRIVATE LIMITED 15.00 to 25.00 Years Bangalore 01 Apr, 2024

Job description

bachelors degree in engineering preferably in Mechanical, Electrical or Instrumentation with CGPA 7.0 or above;

Minimum 8 years of experience in oil and ga...
maximoschedulingmaterial managementpackaginghydraulicsinstrumentationorder managementms projectutility maintenance

Maintenance Engineer
KINAL GLOBAL CARE PRIVATE LIMITED 2.00 to 7.00 Years Bangalore 01 Apr, 2024

Job description

bachelors degree in engineering preferably in Mechanical, Electrical or Instrumentation with CGPA 7.0 or above;

Minimum 8 years of experience in oil and ga...
hydraulicsms projectmaximomaterial managementschedulingorder managementpackagingplant maintenanceinstrumentation

Marketing Manager
MILLENNIUM BABYCARES PRIVATE LIMITED 13.00 to 23.00 Years Bangalore 01 Apr, 2024

An Email Marketing Manager utilizes email communication tools to market a company and increase brand awareness. They are experts in the usage of email communications and develop marketing strateg...
marketservicemarketinganalyticscampaignspowerpointcustomerresearchmanagementdigitalprojectntegratedstrong

CNC Machines
Future Solution Centre 8.00 to 13.00 Years Bangalore 01 Apr, 2024

CNC machines are computer-controlled machines used for manufacturing. Welder/machinists use these machines to fabricate mechanical components, construct wooden mock-ups, and machine specialty pa...
analyticalcncmachinistmathematical

PREV
NEXT

aienabled tools Job Openings

Job description bachelors degree in engineering preferably in Mechanical, Electrical or Instrumentation with CGPA 7.0 or above; Minimum 8 years of experience in oil and ga... maximoschedulingmaterial managementpackaginghydraulicsinstrumentationorder managementms projectutility maintenance

Job description bachelors degree in engineering preferably in Mechanical, Electrical or Instrumentation with CGPA 7.0 or above; Minimum 8 years of experience in oil and ga... hydraulicsms projectmaximomaterial managementschedulingorder managementpackagingplant maintenanceinstrumentation

The Internal Quality Auditor ensures that department processes and the goods and services that result comply with the requirements of standards, as well as customer, regulatory, and the organi... quality auditcall qualitycall auditauditing

Job description bachelors degree in engineering preferably in Mechanical, Electrical or Instrumentation with CGPA 7.0 or above; Minimum 8 years of experience in oil and ga... maximoschedulingmaterial managementpackaginghydraulicsinstrumentationorder managementms projectutility maintenance

Job description bachelors degree in engineering preferably in Mechanical, Electrical or Instrumentation with CGPA 7.0 or above; Minimum 8 years of experience in oil and ga... hydraulicsms projectmaximomaterial managementschedulingorder managementpackagingplant maintenanceinstrumentation

Job description bachelors degree in engineering preferably in Mechanical, Electrical or Instrumentation with CGPA 7.0 or above; Minimum 8 years of experience in oil and ga... maximoschedulingmaterial managementpackaginghydraulicsinstrumentationorder managementms projectutility maintenance

Job description bachelors degree in engineering preferably in Mechanical, Electrical or Instrumentation with CGPA 7.0 or above; Minimum 8 years of experience in oil and ga... hydraulicsms projectmaximomaterial managementschedulingorder managementpackagingplant maintenanceinstrumentation

Job description bachelors degree in engineering preferably in Mechanical, Electrical or Instrumentation with CGPA 7.0 or above; Minimum 8 years of experience in oil and ga... maximoschedulingmaterial managementpackaginghydraulicsinstrumentationorder managementms projectutility maintenance

Job description bachelors degree in engineering preferably in Mechanical, Electrical or Instrumentation with CGPA 7.0 or above; Minimum 8 years of experience in oil and ga... hydraulicsms projectmaximomaterial managementschedulingorder managementpackagingplant maintenanceinstrumentation

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Job description

bachelors degree in engineering preferably in Mechanical, Electrical or Instrumentation with CGPA 7.0 or above;

Minimum 8 years of experience in oil and ga...
maximoschedulingmaterial managementpackaginghydraulicsinstrumentationorder managementms projectutility maintenance

Job description

bachelors degree in engineering preferably in Mechanical, Electrical or Instrumentation with CGPA 7.0 or above;

Minimum 8 years of experience in oil and ga...
hydraulicsms projectmaximomaterial managementschedulingorder managementpackagingplant maintenanceinstrumentation

The Internal Quality Auditor ensures that department processes and the goods and services that result comply with the requirements of standards, as well as customer, regulatory, and the organi...
quality auditcall qualitycall auditauditing

Job description

bachelors degree in engineering preferably in Mechanical, Electrical or Instrumentation with CGPA 7.0 or above;

Minimum 8 years of experience in oil and ga...
maximoschedulingmaterial managementpackaginghydraulicsinstrumentationorder managementms projectutility maintenance

Job description

bachelors degree in engineering preferably in Mechanical, Electrical or Instrumentation with CGPA 7.0 or above;

Minimum 8 years of experience in oil and ga...
hydraulicsms projectmaximomaterial managementschedulingorder managementpackagingplant maintenanceinstrumentation

Job description

bachelors degree in engineering preferably in Mechanical, Electrical or Instrumentation with CGPA 7.0 or above;

Minimum 8 years of experience in oil and ga...
maximoschedulingmaterial managementpackaginghydraulicsinstrumentationorder managementms projectutility maintenance

Job description

bachelors degree in engineering preferably in Mechanical, Electrical or Instrumentation with CGPA 7.0 or above;

Minimum 8 years of experience in oil and ga...
hydraulicsms projectmaximomaterial managementschedulingorder managementpackagingplant maintenanceinstrumentation

Job description

bachelors degree in engineering preferably in Mechanical, Electrical or Instrumentation with CGPA 7.0 or above;

Minimum 8 years of experience in oil and ga...
maximoschedulingmaterial managementpackaginghydraulicsinstrumentationorder managementms projectutility maintenance

Job description

bachelors degree in engineering preferably in Mechanical, Electrical or Instrumentation with CGPA 7.0 or above;

Minimum 8 years of experience in oil and ga...
hydraulicsms projectmaximomaterial managementschedulingorder managementpackagingplant maintenanceinstrumentation