building report with potential clients jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

building report with potential clients Job Openings

Showing 26801 - 26850 of 72143 Jobs

Pipeline Engineer

Garima Interprises 1.00 to 6.00 Years Gurugram,Delhi, Noida, Australia, Austria, Canada, Other AndamanNicobar, Port Blair, Bangalore, Chen 01 Apr, 2025

Pipeline Engineer Job Description Template We are looking for a highly experienced pipeline engineer to design and develop a variety of pipeline...
budgetingblueprintcommunicationrepairconstruction technologytechnical standards

Ppc Head. .

Institute of Selection 10.00 to 12.00 Years Gurugram,Delhi 01 Apr, 2025

Opening for Freelance Recruiter with Talentsphere Management Services

Reema Rai 1.00 to 6.00 Years Gurugram,Delhi, Noida, Bangalore, Kochi, Chennai, Hyderabad, Kolkata, Mumbai City, Mangalore 01 Apr, 2025

Talentsphere Management Services!

fantastic opportunity

screening resumes

executive search

freelance recruitment

Academic Counsellor

Ksirius Consultants Hiring For Aimlay and IIDE 1.00 to 4.00 Years Gurugram,Delhi, Noida, Ambernath, Thane, Mumbai City, Dombivali 01 Apr, 2025

Junior Engineer

Cynosure Corporate Solutions 2.00 to 5.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 01 Apr, 2025

ROLES AND RESPONSIBILITIES:

Measure the boundary of the site with use Googleapp....
equipmentsurveydatamappingsitehandlingcollectionsurveyinginspection

Cluster Head - ADRV Insurance Team Handling Profile Salary Upto 14Lac

Niyukti Management Consultants 10.00 to 17.00 Years Gurugram,Delhi, Noida, Lucknow, Pune, Mumbai City 01 Apr, 2025

Key Specifications:

insurance agency management

Mechanical Supervisor

Xperts Manpower Solutions Enterprises Hiring For Japanese MNC Fresher Gurugram,Delhi, Faridabad, Noida 01 Apr, 2025

machine shop

machine assembly

quality engineering

mechanical maintenance

mechanical engineering

assembly shop

process inspection

production engineering

Purchase Manager - Sec 43, Gurgaon ( Food Industry Experience )

Alpha Pro Services Hiring For Alpha Pro Services 1.00 to 6.00 Years Gurugram 01 Apr, 2025

Purchase Manager - Male

Location:

Job Responsibilities :-

Sr. Electrical Design Engineer

JustHR 8.00 to 13.00 Years Gurugram 01 Apr, 2025

Video Editor - Advertising Agnecy

MEGMA SERVICES 2.00 to 4.00 Years Gurugram 01 Apr, 2025

ob description

Responsible for managing multiple video projects simultaneously. This includes understanding project requirements, establishing timelines and deadlines....
adobe premiere pro2d animationadobe photoshopmotion graphicsadobe after effectscameravideoadobe illustratortrackingeditor

Business Development Manager

KKD Consulting Hiring For Clients 2.00 to 7.00 Years Gurugram,Faridabad, Ghaziabad, Noida, Panchkula, Mohali, Chandigarh, Mumbai City 01 Apr, 2025

KKD IS HIRING

Job Title: Sales Manager - Agency Channel

Company Overview:

sales

outside sales

Freelance Recruiter and Intern

KKD Consulting Hiring For KKD 0.00 to 1.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida, Sonipat, Palwal, Mumbai City, Meerut 01 Apr, 2025

Job Title: Freelance Recruiter & Recruitment Intern

Location:

Job Type:

About Us:

calling

screening

Hvac Design Engineer

JustHR 14.00 to 20.00 Years Gurugram 01 Apr, 2025

Tele Caller

Synergy Plus Business Consulting Group 0.00 to 1.00 Years Gurugram 01 Apr, 2025

Job Title:

Location:

Experience:

bpo

lead generation

customer relationship

Lead Generation Expert

Team Vertex India Global Services Private Limited Hiring For Lead Generation Expert 1.00 to 5.00 Years Gurugram,Delhi 01 Apr, 2025

Job Title:

Location:

Job Summary:

voice process

international call center

Materials Manager

SHARMA ENTERPRISES 3.00 to 8.00 Years Gurugram,Faridabad, Bhiwani, Hisar, Karnal, Kurukshetra, Panchkula, Ambala, Panipat, Kolkata 01 Apr, 2025

Equity Dealer

Apex Services Hiring For One of the leading broking firm 1.00 to 5.00 Years Gurugram,Delhi, Noida, Jaipur, Chandigarh 01 Apr, 2025

Dear Candidate,

Greetings From APEX SERVICES

Role-

EquityDealer

share marketcross sellingthird party productsclient acquisitionequity dealer

E-commerce Account Managment Lead - CBT (Cross Border Trade)
ACUITTY CONSULTANTS LLP Hiring For AcuittyTech 1.00 to 2.00 Years Gurugram 01 Apr, 2025

Key Responsibilities: As an e-commerce account manager, you will work with one of the worlds largest companies to guide their partners ( business-to-businesskey account managementaccountabilitycommunication skillsexport import documentationrelationship buildingms excele-commerce account managementproduct listing

Data Modeler Team Lead/Architect
Angel and Genie 7.00 to 10.00 Years Gurugram 01 Apr, 2025

Data Modeler Architect Position: Data Modeler Architect Experience: 8 years Location: Gurugram Department: IT/Data Architecture Reports to: Data Architecture Lead / Data Manager Position Overvie...
big dataawsdata visualizationgcpazure

Linux Engineer
Angel and Genie 4.00 to 8.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 01 Apr, 2025

Linux (Plesk) Engineers role with us is a strategic bridge between development and IT operations, taking on operational tasks to ensure the efficient functioning of complete infrastructure and it...
linuxhatplesk

Quantity Surveyor
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 14.00 to 24.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City, Guwahati 01 Apr, 2025

Also known as cost consultants, quantity surveyors ensure building projects remain within budget. They provide cost and material estimates, draw up projected budgets, and work alongside a team, ...
quality managementquantity analysisquantity surveyingquality assurancequantity estimationquality control

Marketing Executive
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 14.00 to 24.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Bhagalpur, Hyderabad, Pune, Patna, Guwahati 01 Apr, 2025

Marketing executives coordinate and oversee campaigns geared at promoting products, services, and causes. Marketing executives are adept at a variety of platforms, including print and social med...
marketing researchmarketing communicationmarketing managementbrand managementmarketing

Purchasing Assistant
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 12.00 to 22.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City, Panaji 01 Apr, 2025

Job brief We are seeking a detail-oriented Purchasing Assistant to join our team. Your main responsibility will be to order supplies and equipment in accordance with our companys needs. This...
purchasepurchase requisitionengineeringengineering designengineering managementproject engineeringpurchase management

Hiring For Online Marketing Executive (Work From Home Or Office Both) DELHI-NCR
Desnor Destination Pvt Ltd 0.00 to 4.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida 01 Apr, 2025

Dear Candidate Greetings fromDesnor Destination Pvt Ltd ! Job Summary Idealises Internet Marketing Agency is looking for Marketing Executive to join our dynamic team and embark on a rewarding...
marketing planningdigitaldisplay advertisingmarketingfreelancingwork from homemarketing communicationpart time

Accounting Specialist
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 3.00 to 7.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Pune, Mumbai City 01 Apr, 2025

Check figures, postings, and documents for accuracy. Organize, secure, and maintain all files, records, cash and cash equivalents in accordance with policies and procedures. Record, store, access...
qualitystandardsbillingaccountingfinance executivementorsupervisorpayrollfinancial

Python API -Developer
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 2.00 to 6.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 01 Apr, 2025

Represent API Support with project teams to ensure that API knowledge is provided, thus ensuring effective support for new products and enhancements

Grow an up-to-date knowledg...
data visualizationgitlanguagecssapplication developmentpythonjavascriptchange managementdata structureshyperanalyticshtmlmarkup

Lead Maintenance Supervisor
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 3.00 to 7.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Pune, Mumbai City 01 Apr, 2025

Key Responsibilities:

Team Supervision:

Lead, train, and mentor a team of maintenance technicians and staff.

Assign tasks and p...
programmingwellnessinspectionmanagementvalvesschedulingsafety trainingexecutive engineering

Labourer
ASSETCARE SERVICES PRIVATE LIMITED 1.00 to 5.00 Years Gurugram,Faridabad, Ghaziabad, Noida, Bangalore, Ongole, Chennai, Hyderabad, Kolkata, Patna 01 Apr, 2025

General laborers perform manual duties set out by supervisors. General laborers responsibilities include working with power tools, maintaining a clean work environment and receiving goods. ALabor...
communicationtechnologyliteracybasicinstructionsnumeracyfollowskillsstamina

Chief Talent Officer
SPENTO PAPERS (INDIA) LLP 25.00 to 0.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City, Itanagar 01 Apr, 2025

We are looking for a Chief Talent Officer who will support our talent acquisition and development activities. You will implement regular performance evaluations and be in charge of our employees...
engagementeeosystemhrispayrolldevelopmentorganizationplanningemployeesuccessionexcellentworkforceinterpersonalstrategic

Business Development Manager
ADITYA BIRLA SUN LIFE INSURANCE COMPANY LIMITED 1.00 to 2.00 Years Gurugram,Delhi, Faridabad, Ghaziabad 01 Apr, 2025

Designation:Agency Manager Education:Any Graduates Experience:Fresher with Good network / Min. 1 Yearin anyDomain Sal...
salesinsuranceagency channelbfsi sales

office itor
ASSETCARE SERVICES PRIVATE LIMITED 1.00 to 5.00 Years Gurugram,Delhi, Faridabad, Bangalore, Chennai, Hyderabad, Kolkata, Chittoor, Chandigarh, Ahmedabad 01 Apr, 2025

Janitors work to keep schools, offices, libraries, and hospitals, clean and maintained. They are often asked to work outside normal business hours sometimes early in the morning or late at night ...
adaptabilitycommunication skillsindependencetime managementproblem-solvingphysical stamina

Applications Developer
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 13.00 to 23.00 Years Gurugram,Delhi, Noida, Jaipur, Bangalore, Jaisalmer, Chennai, Hyderabad, Pune, Guwahati 01 Apr, 2025

Job brief We are seeking a qualified and talented Application Developer to join our team. In this role, you will be responsible for designing and coding functional programs and applications. ...
architecture governancevalue engineeringconstruction managementdeveloper/d2kengineeringapplication architecture

Plant Engineer
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 12.00 to 22.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Nellore, Hyderabad, Kolkata, Pune, Mumbai City 01 Apr, 2025

We are looking for a Plant Manager to drive continuous improvement and optimization of all processes.
Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla...
project engineeringprocess equipmentengineering processengineeringplant engineering

Business Associate
ALTSEO PRIVATE LIMITED 15.00 to 25.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 01 Apr, 2025

We are looking for an energetic business development associate to help drive our sales and grow the business. You will attract new clients and build solid relationships with them while maintainin...
visualizationsalesservicemanagementmarketingterminologycommunicationcustomerprojectmedicalstatementsskills

NTT DATA Virtual Drive Hedge Fund Gurgaon
NTT DATA INFORMATION PROCESSING SERVICES PRIVATE LIMITED 1.00 to 3.00 Years Gurugram 01 Apr, 2025

NTT DATA is Hiring experienced candidates for Hedge Fund Accounting domain. Location:Gurgaon Sector 48 (Candor Techspace) Work from Office Only Shift ...
reconciliationhedge fundsnav calculationinvestment banking

Business Development Manager
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 8.00 to 12.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Pune, Mumbai City 01 Apr, 2025

Key Responsibilities:

Strategic Planning: Develop and execute strategic business development plans that align with company goals and target ma...
sales growthanalysismarket analysisadaptabilityadministration workmarketcommunicationstrategic planningstrategic thinkinginnovationnegotiationcontractsresearch

Hospital Manager
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 13.00 to 18.00 Years Gurugram,Delhi, Bangalore, Kochi, Chennai, Hyderabad, Kolkata, Kollam, Thiruvanananthapuram, Mumbai 01 Apr, 2025

We are looking for an experienced Hospital Administration Manager to run our medical facility. To be successful in this role, you should have a deep understanding of all administrative hospital ...
problemmanagementbudgetingassurancecollaborationcommunicationqualityfinancialsolving

Design Verification Engineer
GLOBEX DIGITAL SOLUTIONS PRIVATE LIMITED 6.00 to 11.00 Years Kochi,Bangalore, Chennai, Noida, Hyderabad, Gurugram, Pune, Mumbai City, Delhi, Ahmedabad 01 Apr, 2025

Greeting form Globex Digital.! Please find the job description for _Design Verification Engineer interested please revert back with updated resume. JD: Design Verification Engineer Experience:...
uvmsystem verilogdesign verificationsub systems

Material Management Executive
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 10.00 to 19.00 Years Thiruvanananthapuram,Other Maharashtra, Bangalore, Chennai, Other Tamil Nadu, Hyderabad, Kolkata, Mu 01 Apr, 2025

Our growing business is searching for a qualified materials manager to oversee our inventory and purchasing operations. If you are an experienced and competent individual with in-depth knowledge ...
supply chain managementlogistics coordinationpurchase orderscontinuous improvementmaterial planning

Hospital Manager
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 13.00 to 18.00 Years Kochi,Kollam, Thiruvanananthapuram, Bangalore, Chennai, Hyderabad, Gurugram, Kolkata, Mumbai City, D 01 Apr, 2025

We are looking for an experienced Hospital Administration Manager to run our medical facility. To be successful in this role, you should have a deep understanding of all administrative hospital ...
problemmanagementbudgetingassurancecollaborationcommunicationqualityfinancialsolving

for Sales Warrior & Relationship Manager
RELIANCE NIPPON LIFE INSURANCE COMPANY LIMITED 1.00 to 6.00 Years Other Kerala,Chennai, Other Tamil Nadu 01 Apr, 2025

JobDescription Direct Marketing Channel Designation: Sr. Relationship Manager/Executive Relationship Manager Roles & Responsibilities...
agency channelsalesinsurance salesmarketingbusinessagency

Hiring for Sales Warrior- Kerala
RELIANCE NIPPON LIFE INSURANCE COMPANY LIMITED 1.00 to 6.00 Years Kannur,Kochi, Other Kerala 01 Apr, 2025

RNLIC - Hiring for Kerala Location. All the localite of Kerala - Opportunity for work on on role with RNLIC Direct Marketing Channel ...
agency channelsalesbfsiagencybusinessinsurance sales

Procurement Assistant
SHARMA ENTERPRISES 1.00 to 6.00 Years Ernakulam,Kochi, Kozhikode, Malappuram, Thrissur, Gwalior, Indore, Bokaro, Ranchi, Bhopal 01 Apr, 2025

We are currently searching for a Procurement Assistant supports the purchasing and supply chain processes, assisting with tasks like sourcing suppliers, preparing purchase orders, maintaining pro...
purchase operationssupplier quality assurancesourcing materialsinventory managementrecord maintenancedata analysisrecord keeping

Team Coordinator
SHARMA ENTERPRISES 4.00 to 9.00 Years Ernakulam,Idukki, Kannur, Kasargod, Kochi, Kollam, Kottayam, Kozhikode, Thrissur, Wayanad 01 Apr, 2025

We are looking for a result-driven team leader to be responsible for monitoring and supervising a team of consultants to achieve the organizations objectives and increase sales. You will be respo...
navigationanalysisconflict preventioncommunication skillsproblem solvingleadership managementmanagement reportingcontrolreportingtask completionorganizational administration

Floorman vacancy
Apex Offshore Services 0.00 to 1.00 Years Ernakulam,Idukki, Kochi, Kozhikode, Palakkad, Thrissur, Other Madhya Pradesh, Vishakhapatnam, Kakina 01 Apr, 2025

Greeting Walk-in Interview starts in Mumbai we are hiring for the position of Floormanwith a leading Oil & Gas Industry Job Responsi...
gasdrillingoffshore platformsoildiploma in drilling engineer

Product Manager
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 15.00 to 25.00 Years Ernakulam,Wayanad, Pala, Thiruvananthapuram, Gwalior, Indore, Jabalpur, Bhopal, Ratlam, Sagar 01 Apr, 2025

Job brief We are looking for an experienced Product Manager who is passionate about building products that customers love. You will join a dynamic and fast-paced environment and work with c...
product sourcingproduct marketingproduction engineeringproduct managementproduct manufacturing

3D Visualizer
ED Group Pvt Ltd 1.00 to 5.00 Years Kochi,Other Kerala 01 Apr, 2025

We are hiring! Position: 3D Visualizer Experience: 1-2 years** Location: Kochi, Kerala Only apply if you are proficient using Sketchup, Lumion and D5 Render.* Key Responsibilities: Create hig...
SketchupLumionAutoCAD

Territory Sales Manager
Linways Technologies 2.00 to 6.00 Years Kochi,Other Kerala 01 Apr, 2025

Kochi, Kerala Work Type: Full Time Location : Mangalore, India(Candidates who are willing to relocate can apply) B2B Corporate Sales Aggressively use phone, emails and other sales & marketing t...
Sales PresentationsCRM ManagementB2B Corporate SalesSalesMarketing

Field Marketing Manager
LEADERS GROUP 2.00 to 6.00 Years Kannur,Other Kerala 01 Apr, 2025

Were Hiring: Field Marketing Manager Are you a results-driven marketer who loves on-ground activations and outreach Join our team as a Field Marketing Manager and lead impactful marketing campai...
Offline MarketingEvent ManagementBrand AwarenessLead GenerationTeam ManagementCampaign AnalysisCommunication SkillsRelationship BuildingSponsorship ManagementPartnership BuildingBTL ActivitiesDatadriven

E2E CNX Architect / CNX Solution Architect
Infosys Limited 4.00 to 8.00 Years Other Kerala,Thiruvananthapuram 01 Apr, 2025

Key Responsibilities: A day in the life of an Infoscion As part of the Infosys consulting team your primary role would be to lead the engagement effort of providing high quality and value adding...
AWSDevOpsGoogle Cloud PlatformKubernetesTelecomSDLCAgile MethodologiesProject ManagementTeam ManagementAgile CoachBusiness Analyst

PREV
NEXT

building report with potential clients Job Openings

Pipeline Engineer Job Description Template We are looking for a highly experienced pipeline engineer to design and develop a variety of pipeline... budgetingblueprintcommunicationrepairconstruction technologytechnical standards

About Us:

Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla... project engineeringprocess equipmentengineering processengineeringplant engineering

Key Responsibilities:

Job brief We are looking for an experienced Product Manager who is passionate about building products that customers love. You will join a dynamic and fast-paced environment and work with c... product sourcingproduct marketingproduction engineeringproduct managementproduct manufacturing

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Pipeline Engineer Job Description Template We are looking for a highly experienced pipeline engineer to design and develop a variety of pipeline...
budgetingblueprintcommunicationrepairconstruction technologytechnical standards

Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla...
project engineeringprocess equipmentengineering processengineeringplant engineering

Job brief We are looking for an experienced Product Manager who is passionate about building products that customers love. You will join a dynamic and fast-paced environment and work with c...
product sourcingproduct marketingproduction engineeringproduct managementproduct manufacturing