circuit connections jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

circuit connections Job Openings

Showing 2901 - 2950 of 3017 Jobs

Field ELV Project Engineer

Florican Enterprises Pvt Ltd 1.00 to 3.00 Years Bangalore 23 Oct, 2023

hidden_email

hidden_mobile

field sales

mqtt

Application Technical Engineer

G K Manpower Consultants 5.00 to 10.00 Years Pune 20 Oct, 2023

application engineering

low voltage switchgears

medium voltage switchgears

Customer Manager

AVHAD ENTERPRISES 5.00 to 10.00 Years Delhi 20 Oct, 2023

We are searching for a detail-oriented, dependable telecom engineer and their work ranges from creating basic circuit design to deploy the wireless network in the field. ...
telecommunication servicescommunication managementtelecommunications marketingtelecom project managementcommunication engineeringtelecommunicationcommunicationtelecom testingtelecom engineering

Pcb Design Engineer
Vijaya Enterprises 3.00 to 5.00 Years Navi Mumbai 20 Oct, 2023

JOB DESCRIPTION

Should have through knowledge on

CAD software such as AutoCAD,Design Spark & Altium

Should have basic kno...
schematic capturepcb design

Application Technical Engineer
G K Manpower Consultants 5.00 to 10.00 Years Mumbai City 20 Oct, 2023

Job Title: Application Technical Engineer Location: Dubai Product Profile: Low Voltage and Medium Voltage Switchgear and related ancillary items Reporting To: Divisional Manager PRINCIPLE ACC...
application engineeringlow voltage switchgearsmedium voltage switchgearsengineering projectsancillary servicesswitchgeardesign engineering

Electrical Technician
GLOBAL WINGZ CAREERS 2.00 to 7.00 Years Navi Mumbai 20 Oct, 2023

Dear Applicants, Greetings from Global Wingz Careers LLP!! We are looking for applicants willing to work for Dubai Position Available Electrical Technician: Salary Dhs. 1600.00 - 1800.00 45 ...
blueprintelectrical maintenancelighting systemstechnical drawingtechnical supportelectrical codeelectrical testingelectrical equipment

Customer Manager
AVHAD ENTERPRISES 5.00 to 10.00 Years Hyderabad 20 Oct, 2023

We are searching for a detail-oriented, dependable telecom engineer and their work ranges from creating basic circuit design to deploy the wireless network in the field. ...
telecommunication servicescommunication managementtelecommunications marketingtelecom project managementcommunication engineeringtelecommunicationcommunicationtelecom testingtelecom engineering

Electrical Technician
GLOBAL WINGZ CAREERS 2.00 to 7.00 Years Gurugram 20 Oct, 2023

Dear Applicants, Greetings from Global Wingz Careers LLP!! We are looking for applicants willing to work for Dubai Position Available Electrical Technician: Salary Dhs. 1600.00 - 1800.00 45 ...
blueprintelectrical maintenancelighting systemstechnical drawingtechnical supportelectrical codeelectrical testingelectrical equipment

Senior Embedded Hardware Engineer
NEURANICS LAB PVT LTD 2.00 to 7.00 Years Delhi 20 Oct, 2023

As a Senior Embedded Design Engineer at Neuranics Lab, you will play a crucial role in designing, developing, and optimising embedded systems for our state-of-the-art blood diagnostic devices. Yo...
high speed designaltium designerdigital circuit designfpga designanalog circuit designverilog hdlmodelsim

Application Technical Engineer
G K Manpower Consultants 5.00 to 10.00 Years Delhi 20 Oct, 2023

Job Title: Application Technical Engineer Location: Dubai Product Profile: Low Voltage and Medium Voltage Switchgear and related ancillary items Reporting To: Divisional Manager PRINCIPLE ACC...
application engineeringlow voltage switchgearsmedium voltage switchgearsengineering projectsancillary servicesswitchgeardesign engineering

Electrical Technician
GLOBAL WINGZ CAREERS 2.00 to 7.00 Years Chennai 20 Oct, 2023

Dear Applicants, Greetings from Global Wingz Careers LLP!! We are looking for applicants willing to work for Dubai Position Available Electrical Technician: Salary Dhs. 1600.00 - 1800.00 45 ...
blueprintelectrical maintenancelighting systemstechnical drawingtechnical supportelectrical codeelectrical testingelectrical equipment

Power Electronics Engineer
Talent Hunt Management Hiring For Quess corp 7.00 to 12.00 Years Bangalore 20 Oct, 2023

Qualifications and Experience: Immediate to 10 days Location-Address: 4th Floor, Du Parc Trinity, 17, Mahatma Gandhi Rd, opposite Vija...
pspicepower electronicsltspicealtium

Customer Manager
AVHAD ENTERPRISES 5.00 to 10.00 Years Mumbai City 18 Oct, 2023

We are searching for a detail-oriented, dependable telecom engineer and their work ranges from creating basic circuit design to deploy the wireless network in the field. ...
telecommunication servicescommunication managementtelecommunications marketingtelecom project managementcommunication engineeringtelecommunicationcommunicationtelecom testingtelecom engineering

Pharmacologist
AVHAD ENTERPRISES 5.00 to 10.00 Years Mumbai City 18 Oct, 2023

We are searching for a connected pharmaceutical sales representative to augment our team of expert staff. The pharmaceutical sales representative will be required to forge relationships w...
safety pharmacologypharmacologynephrologyhospital administrationpharmaceutical salespharmaceutical productionmedical billingdrug developmentgastroenterology

P.E hardware design
Talent Hunt Management 6.00 to 10.00 Years Bangalore 18 Oct, 2023

Looking for someone who has worked onP.E hardware designwith LTSpice /pspice /Altium tools.We have F2F drive on thursday. Qualifications and Experience: pspicepower electronics designhardware designpower electronicsspice

Manager Business Process Analyst
Topgear Consultants Private Limited 8.00 to 12.00 Years Bangalore 18 Oct, 2023

Hiring for one of the leading Pharmaceutical Company. Role: Manager Business Process Analyst Roles and Responsibilities:

Minimum 10 years of experi...
sap hanasap implementationsap analytics cloudsac planning

Lead Information Security Engineer
MasterCard 0.00 to 4.00 Years Vadodara 16 Oct, 2023

Our Purpose We work to connect and power an inclusive, digital economy that benefits everyone, everywhere by making transactions safe, simple, smart and accessible. Using secure data an...
application securitynetworkingactive directorychange managementcomplianceit security policiesperformance appraisal processinformation security engineeringit securitysecure codingproject teamslarge projectsdigital economycustomer surveysdisas

Senior Embedded Hardware Engineer
NEURANICS LAB PVT LTD 2.00 to 7.00 Years Gurugram 16 Oct, 2023

As a Senior Embedded Design Engineer at Neuranics Lab, you will play a crucial role in designing, developing, and optimising embedded systems for our state-of-the-art blood diagnostic devices. Yo...
high speed designaltium designerdigital circuit designfpga designanalog circuit designverilog hdlmodelsim

Embedded Design Engineer
Orbitouch Outsourcing Private Limited 2.00 to 7.00 Years Chennai 16 Oct, 2023

Urgent hiring forEmbedded Design Engineer || Chennai || WFO Location- Chennai Designation- Engineer - Electrical & Electronics Engineering Experience- 2 years Ctc- 4.20 LPA(D...
embedded designcircuit designing

Sales Acceleration Manager (SAM) - Sales & strategy, Partner engagement, revenue |7-10 yrs
Cisco Systems, Inc 4.00 to 10.00 Years Pune 12 Oct, 2023

The role is a highly visible, strategic role within Cisco s SMB organization working with our Distributors & Partners in the assigned territory. The successful candidate will directly impact the...
pop culturesales strategysuccess storieschannel partnerspartner engagementstrategic insightscustomer engagementgtmecosmbsetpoprestsalesgraspaccesssolver

Network Engineer
ARYAN TECHNOLOGY 0.00 to 4.00 Years Mumbai City 12 Oct, 2023

Network Engineer Job Responsibilities:

Establishes and maintains network performance.

Builds net configurations and connections.

Troubleshoots netw...
ccnptroubleshootingccienetworkingccnaroutersswitches

Carpenter Foreman in Dubai
Always International Manpower Service Hiring For Electrician Plumber Mason Welder job in Dubai 1.00 to 5.00 Years Hyderabad 12 Oct, 2023

We are Electrician Plumber Mason Carpenter Welder job in Dubai o Basic Salary 1200 to 2000 AED. ( 25k to 45k ) o Other Allowance 300 AED. o Accommodation Provided by Company. o Transportation...
carpentryweldingmasonplumbingelectricity

Sr Principal Engineer-Electrical
Baxter India 15.00 to 19.00 Years Bangalore 12 Oct, 2023

Sr Principal Engineer-Electrical This is where you save and sustain lives At Baxter, we are deeply connected by our mission. No matter your role at Baxter, your...
javajavascriptequipment supplyframeworksafety criticallinux

Support Engineer (Mumbai)
Pleasant Inc 0.00 to 4.00 Years Mumbai City 10 Oct, 2023

Support Engineer

Taking ownership of customer issues reported and seeing problems through to resolution

Researching, diagnosing, troubleshooting and identifying solution...
troubleshootingnetworkingit helpdeskremote desktopdesktop supporttechnical support

Community BuilderManager
Jobs Territory 3.00 to 6.00 Years Mumbai City 06 Oct, 2023

Job Role: Community Builder Location: Mumbai Experience-3 to 5 years in the same domain. Your primary goal will be to build and maintain an active and engaged community that advocates for our...
contentnegotiation skillsconflict resolutioncommunication skillsmarketingcommunity buildingcollaboration

Sr Eng, Electrical
Baxter India 8.00 to 12.00 Years Bangalore 06 Oct, 2023

You will develop creative solutions to challenging problems associated with the design of our new and existing infusionsystem product portfolio.

The successful candida...
power integritydata acquisitionmedical devicesequipment supplyproblem solvingelectrical designiec 60601

Hiring for Maintenance Technician Algeria
GLOBAL WINGZ CAREERS Hiring For Hiring for Maintenance Technician_Algeria 1.00 to 4.00 Years Mumbai City 04 Oct, 2023

Dear Applicants, Greetings from Global Wingz Careers LLP!! We are looking for applicants willing to work for Saudi Algeria Position Availa...
mechanicalelectrical maintenancemechanical engineeringelectricalsautomation

Applications invited for General Manager / Chief Engineer (Electrical) at APMD
Amity University 5.00 to 14.00 Years Noida 03 Oct, 2023

Applications invited for General Manager / Chief Engineer (Electrical) at APMD - 12-10-2022 - Adv/AUUP/HR/21/093 Advertisement Date: 12-10-2022 Adv/AUUP/HR/21/093 AMITY UNIVERSITY We at Amity Powe...
mechanicalsafetymachineryhvacplumbingair conditioningpower managementcommunication skillsverbal communicationelectrical engineeringpansolarsoundresumeengineersmanagement

Technical Solution Architect, Webex Customer Experience (Contact Center & CPaaS) India
Cisco Systems, Inc 4.00 to 6.00 Years Mumbai City 03 Oct, 2023

What You ll Do As a Webex Customer Experience Technical Solutions Architect (TSA), your primary responsibility is to provide technical guidance and presales engineering support for Customer Expe...
accountsnegotiationstoragecapacity planningconsultingpop culturetrade showscustomer carecontact centertechnical salessolution designcustomer experienceengineering supportbusiness developmentrequirements gatheringcalendar managementrestful

Sales Executive
VERTEX BRIGHT SOLUTION Hiring For Sales Executive 0.00 to 2.00 Years Delhi 03 Oct, 2023

This is great opportunity for an experienced Pre - sales Professional to join a young & successful team in a dynamic and fast - paced growth environment. The successful candidate should be highly...
field workbanking

Hiring for Maintenance Technician Algeria
GLOBAL WINGZ CAREERS Hiring For Hiring for Maintenance Technician_Algeria 1.00 to 4.00 Years Pune 02 Oct, 2023

Dear Applicants, Greetings from Global Wingz Careers LLP!! We are looking for applicants willing to work for Saudi Algeria Position Availa...
mechanicalelectrical maintenancemechanical engineeringelectricalsautomation

Hiring for Maintenance Technician Algeria
GLOBAL WINGZ CAREERS Hiring For Hiring for Maintenance Technician_Algeria 1.00 to 4.00 Years Noida 02 Oct, 2023

Dear Applicants, Greetings from Global Wingz Careers LLP!! We are looking for applicants willing to work for Saudi Algeria Position Availa...
mechanicalelectrical maintenancemechanical engineeringelectricalsautomation

Sales Executive
VERTEX BRIGHT SOLUTION Hiring For Sales Executive 0.00 to 2.00 Years Mumbai City 02 Oct, 2023

This is great opportunity for an experienced Pre - sales Professional to join a young & successful team in a dynamic and fast - paced growth environment. The successful candidate should be highly...
field workbanking

Sales Acceleration Manager, Partner Managed Services - Mumbai
Cisco Systems, Inc 3.00 to 5.00 Years Mumbai City 02 Oct, 2023

What You ll Do You will be responsible for driving the sales acceleration of Managed services created by our S/MSPs. You will have Specific (Managed Services) Partner(s...
strong business acumensmb salespop culturesales growthservice salesbusiness acumensales enablementmanaged servicescommercial saleswork effectivelysales forecastingsales initiativesstrategic thinkingpartner engagementbusiness development

Hiring for Maintenance Technician Algeria
GLOBAL WINGZ CAREERS Hiring For Hiring for Maintenance Technician_Algeria 1.00 to 4.00 Years Gurugram 02 Oct, 2023

Dear Applicants, Greetings from Global Wingz Careers LLP!! We are looking for applicants willing to work for Saudi Algeria Position Availa...
mechanicalelectrical maintenancemechanical engineeringelectricalsautomation

Business Development Executive Outstation
C S Creative Solutions 0.00 to 1.00 Years Delhi 02 Oct, 2023

Dear candidates, Immediate Job Opening for Marketing Executive / BDM Executive Are you a high school graduate or a fresh graduate with a keen interest in Marketing and Business Development Are...
business developmentcustomer relationship

Sales Acceleration Manager, Partner Managed Services - New Delhi
Cisco Systems, Inc 3.00 to 5.00 Years Delhi 02 Oct, 2023

What You ll Do You will be responsible for driving the sales acceleration of Managed services created by our S/MSPs. You will have Specific (Managed Services) Partner(s...
strong business acumensmb salespop culturesales growthservice salesbusiness acumensales enablementmanaged servicescommercial saleswork effectivelysales forecastingsales initiativesstrategic thinkingpartner engagementbusiness development

Electrician Engineer
AWINMO INDIA MARKETING PRIVATE LIMITED 9.00 to 14.00 Years Chennai 02 Oct, 2023

Electrician Job Description Template We would like to hire an electrician to join our team. You will be responsible for installing and repairing compl...
basiccommunicationcustomerteamworkproblemtimemanagement.math.solving.service.fitness.

Application Developer AWS Cloud FullStack
IBM India Pvt Limited 3.00 to 11.00 Years Pune 29 Sep, 2023

Introduction As an Application Developer, you will lead IBM into the future by translating system requirements into the design and development of customized systems in an agile environment. The su...
javajavascriptsqlcustomer relationshtmldesign thinkingcreative designnetwork securitycircuit breakerssystem requirementsagile methodologiesinterpersonal skillsconfiguration managementapiawssdkecs

Technical Solution Architect, Managed Services - Mumbai
Cisco Systems, Inc 12.00 to 14.00 Years Mumbai City 29 Sep, 2023

Who You LL Work With Part of the APJC Partner organization, the role of Technical solutions Architect is responsible for the creation, maintenance and management of IT architect...
accountsnegotiationstoragecapacity planningconsultingreturn on investmentsubject matter expertiseenterprise network securitydata centerpop culturebusiness caseuser experienceit architecturenetwork securitymanaged servicesproject execution

Data Center Engineering Operations , Infraops
Amazon 2.00 to 4.00 Years Mumbai City 29 Sep, 2023

Amazon is expanding the Data Center management team in India. This position within Amazon Data Services India Private Limited (ADSIPL) requires broad Data Center knowledge with Subject Matter Exp...
networkingdhcplinuxtroubleshootingwindowsroot cause analysisdata center operationsdata center managementsubject matter expertisedata center constructionmission critical facilitiesstandard operating proceduresproject engineering managementroot

RF Design Engineer
Orcapod Consulting Services Pvt Ltd 6.00 to 11.00 Years Hyderabad 29 Sep, 2023

Key Responsibilities:

Extensive experience in planning tools like Atoll

Detailed understanding of inputs required, tilt/azimuth/height optimization, proposin...
rf engineeringlte

Lead, Big Data Analytics & Engineering
MasterCard 8.00 to 10.00 Years Gurugram 29 Sep, 2023

Our Purpose We work to connect and power an inclusive, digital economy that benefits everyone, everywhere by making transactions safe, simple, smart and accessible. Using secure data an...
big data analyticsbig datadata miningdata sciencedata analysisdata analyticsdata solutionsdigital economymachine learningdata integrationdigital identityproduct managementdata visualizationproduct developmententerprise businessinformation s

Network Engineer
ARYAN TECHNOLOGY 0.00 to 4.00 Years Chennai 29 Sep, 2023

Network Engineer Job Responsibilities:

Establishes and maintains network performance.

Builds net configurations and connections.

Troubleshoots netw...
ccnptroubleshootingccienetworkingccnaroutersswitches

Network Engineer
PRINCETON IT SERVICES PRIVATE LIMITED 5.00 to 8.00 Years Chennai 29 Sep, 2023

Position :Network Engineer Location : Chennai or Remote for other states Position Type :FTE you will be Reporting to the Global Infrastructur...
hardware maintenancenetwork securitynetworking

Immediate Opening for SAP PI-EDI Consultant
Schneider Electric 8.00 to 10.00 Years Bangalore 29 Sep, 2023

*

Must have 8 years of Hand-On experience on the below topics

Extensive experience in Design, develop and delivering Integration in SAP PI/PO and SAP B2B Integration and any othe...
sap applicationprocess architectureb2b integrationsapb2brest

System Engineer - Power Electronic Systems
Bosch Group 5.00 to 7.00 Years Pune 27 Sep, 2023

Job Description

5 years of experience in SW system designer experience in ICE, Electric or Hybrid Power Train

System & SW Requirement Engineering and Elicitation

Technic...
troubleshootingcustomer relationsjavasqlnetworkingverificationvalidationsystem designsystem engineeringsystem architecturesoftware requirementsrequirement engineeringoemicesdlcdesigncircuitsoftwarevalidationsimulation

Sales Executive
VERTEX BRIGHT SOLUTION Hiring For Sales Executive 0.00 to 2.00 Years Pune 27 Sep, 2023

This is great opportunity for an experienced Pre - sales Professional to join a young & successful team in a dynamic and fast - paced growth environment. The successful candidate should be highly...
field workbanking

Regional Sales Manager
Evoke HR Solutions Pvt Ltd 5.00 to 10.00 Years Hyderabad 27 Sep, 2023

- strong knowledge of market - proficient with sales oftiles, bath, sanitary wares - Team Handling - Area , Region handling ...
tilessalesmarketing

Regional Sales Manager
Evoke HR Solutions Pvt Ltd 5.00 to 10.00 Years Bangalore 27 Sep, 2023

- strong knowledge of market - proficient with sales oftiles, bath, sanitary wares - Team Handling - Area , Region handling ...
tilessalesmarketing

PREV
NEXT

circuit connections Job Openings

Electrician Job Description Template We would like to hire an electrician to join our team. You will be responsible for installing and repairing compl... basiccommunicationcustomerteamworkproblemtimemanagement.math.solving.service.fitness.

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Electrician Job Description Template We would like to hire an electrician to join our team. You will be responsible for installing and repairing compl...
basiccommunicationcustomerteamworkproblemtimemanagement.math.solving.service.fitness.