civil designs jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

civil designs Job Openings

Showing 8801 - 8850 of 9125 Jobs

Ui Ux Designer

MNR Solutions Pvt Ltd 4.00 to 9.00 Years Bangalore 22 Sep, 2023

Urgent Hiring For UI/UX Designer-Bangalore.

Experience

CTC

Qualification

REACT JS DEVELOPER-Vishakapatnam

Concept Consultant Service 4.00 to 9.00 Years Vishakhapatnam 14 Sep, 2023

Leverage the inbuilt React toolkit for creating frontend features
Create data visualizat...
javascriptcssgit

preservation engineer

AVHAD ENTERPRISES 7.00 to 12.00 Years Vijayawada 14 Sep, 2023

construction

fuel injection

front end engineering design

engine management systems

engineering

engineer

Electrician - Vadodara

Foursis Technical Solution 2.00 to 3.00 Years Vadodara 14 Sep, 2023

Job functions area :

Location :

Experience :

Skills : designdraftingmechanicalmaintenanceDesign FirmsPattern CuttingDesignCADPattern MakingCreative Pattern Cutting

Head Engineering - Vadodara
Foursis Technical Solution 8.00 to 11.00 Years Vadodara 14 Sep, 2023

Job functions area : Engineering / Manufacturing / Production / Maintenance Location : Vadodara Experience : 8 - 11 years Skills ...
mechanicalmachinerycivilsafetysapquality checkmonitoringmaintenanceengineeringdocumentationKaizenRoot Cause AnalysisSix Sigma

Require for Jr. Design Engineer Electrical - Vadodara
Foursis Technical Solution 2.00 to 3.00 Years Vadodara 14 Sep, 2023

Job functions area : Design / Drafting (Electrical / Mechanical / Civil) Location : Vadodara Experience : 2 - 3 years Skills : drawingautocaddraftingmodelingcadproduct managementelectrical maintenancedesignmanagementmechanical

UI-UX Designer -Pune(Kalyani Nagar)-WFO!
Talent Corner HR Services Pvt Ltd 4.00 to 8.00 Years Pune 14 Sep, 2023

Job Description Experience: UI/UX Designer- (4- 8 years) Education: Any Bachelors Degree Location: Pune(Kalyani Nagar)-WFO Working Days: Monday to Friday A...
ui designillustratorphotoshopux/ui designadobe illustrator

We have requirement for Service Operation Specialist IMS
Nokia Solutions and Networks India Pvt Ltd 7.00 to 12.00 Years Pune 14 Sep, 2023

Join us in creating the technology that helps the world act together We are a B2B technology innovation leader pioneering the future where networks meet cloud. At Nokia you...
technical supportcore networkpreventive maintenancesystem integration

HIRING FOR Mechanical Design Engineer
Manpower Solution Fresher Pune 14 Sep, 2023

Mechanical Design Engineer Job Description Template We are looking to hire a talented mechanical design engin...
mechanical maintenancemechanical electrical plumbingmechanical designmechanical testing

CONTRACT TO HIRE - ServiceNow GRC Consultant
Shell Info Technologies Pvt Ltd 3.00 to 8.00 Years Pune 14 Sep, 2023

Job Description

Certified Application Developer and Certified System Administrator

Implementing and delivering GRC technology enablement services usi...
riskmanagementauditservicenowcompliancepolicy

Senior Fashion Designer
Delta Recruitment Consultants Private Limited 7.00 to 10.00 Years Mumbai City 14 Sep, 2023

Senior fashion Designer Salary AED 5000 plus other benefits. Experience must be 7 to 10 years in a reputed garment manufacturing units. corel drawfabricphotoshopwovensillustratorindesignknitsadobefashion trends

Sales executive
DC Consultants 0.00 to 2.00 Years Navi Mumbai 14 Sep, 2023

We have an urgent opening for the position ofSales Executivefor theNavi Mumbailocation. Key Points:

B2B and B2C sales of automation<...
sales planningbrand marketingsalesbusiness developmentcustomer support executive

Architect Interior Designer
Maargeen Consultancy Private Limited 2.00 to 4.00 Years Mumbai City 14 Sep, 2023

We are seeking an experienced architects who have experience in interiors specifically and overseeing various types of projects, including residential, interior design, and exhibition pro...
interior architectureinterior designingresidential projectsinterior design projectsarchitect interior designer

Civil Site Engineer
Maargeen Consultancy Private Limited 0.00 to 1.00 Years Mumbai City 14 Sep, 2023

Interpretation of all types of Drawing and able to find out mistakes

Mivan Formwork/Mivan Shuttering

Data management

Com...
civil worksautocadbbsmivanquantity knowledge

Junior Fashion Designer
Delta Recruitment Consultants Private Limited 5.00 to 8.00 Years Mumbai City 14 Sep, 2023

Juniorfashion Designer Salary AED 3500 plus other benefits. Experience must beMinimum 5years in a reputed garment manufacturing units. illustratorphotoshopfabriccorel drawwovensfashion trendsadobe

preservation engineer
AVHAD ENTERPRISES 7.00 to 12.00 Years Hyderabad 14 Sep, 2023

We are looking for an innovative, dedicated engineer who has a broad and general fascination with the engineering sciences and who follows international engineering trends and technologies. The e...
constructionfuel injectionfront end engineering designengine designoilengineering servicesgasenergydesignengine management systemsengineeringengineer

CONTRACT TO HIRE - ServiceNow GRC Consultant
Shell Info Technologies Pvt Ltd 3.00 to 8.00 Years Gurugram 14 Sep, 2023

Job Description

Certified Application Developer and Certified System Administrator

Implementing and delivering GRC technology enablement services usi...
riskmanagementauditservicenowcompliancepolicy

Associate Analyst/Analyst/AM Actuarial
Sun Life India 2.00 to 5.00 Years Gurugram 14 Sep, 2023

Hands-on management of a team of highly skilled software developers, testers and domain experts - ensuring great execution of Agile/SCRUM processes and repeatable, predictable, and high-quality de...
riskcustomer relationsresearchcompliance

Package Consultant SAP Ariba
IBM India Pvt Limited 1.00 to 3.00 Years Gurugram 14 Sep, 2023

Introduction As a Package Consultant at IBM, get ready to tackle numerous mission-critical company directives. Our team takes on the challenge of designing, developing and re-engineering highly co...
source to paysap srmbusiness process designsupply chain solutions

CONTRACT TO HIRE - ServiceNow GRC Consultant
Shell Info Technologies Pvt Ltd 3.00 to 8.00 Years Noida 14 Sep, 2023

Job Description

Certified Application Developer and Certified System Administrator

Implementing and delivering GRC technology enablement services usi...
riskmanagementauditservicenowcompliancepolicy

SAP Fuel Management Consultant
Best Infosystems Ltd 8.00 to 12.00 Years Panchkula 14 Sep, 2023

Job Tittle:SAP Fuel Management Consultant Job Type:Full-Time Location:Haryana-Panchkula Experience:8-12 years JD: Roles and Responsibilities: SAP FSCM Lead (Fuel Supply Chain Management) SAP ...
sapfuel management

CONTRACT TO HIRE - ServiceNow GRC Consultant
Shell Info Technologies Pvt Ltd 3.00 to 8.00 Years Chennai 14 Sep, 2023

Job Description

Certified Application Developer and Certified System Administrator

Implementing and delivering GRC technology enablement services usi...
riskmanagementauditservicenowcompliancepolicy

Sap Ewm Consultant
V tech it solutions 0.00 to 3.00 Years Bangalore 14 Sep, 2023

Hi Job Seekers, We have a job opening for SAP EWM entry level fresher consultants to our Reputed MNC Client Companies with Remote Locations. Positions ...
sap ewmsap functional consultantssap inventory managementsap supply chainsap projectssap warehouse managementsap logistics executionsap applicationssap delivery management

Ui Ux Designer - Bangalore
MNR Solutions Pvt Ltd 4.00 to 9.00 Years Bangalore 14 Sep, 2023

Urgent Hiring For UI/UX Designer-Bangalore. Experience- 4 years minimum CTC upto- 8 LPA Qualification -Gr...
javascriptadobe photoshopcssui design

Chief Engineers & Assistant Chief Engineers
AWINMO INDIA MARKETING PRIVATE LIMITED 8.00 to 13.00 Years Bangalore 14 Sep, 2023

Chief Engineer Job Description Template We are searching for a chief engineer with excellent leadership abilities to oversee multiple company proj...
managementcreativity skillsanalyticalprojectskills.problem-solvingcritical

Network & Security Engineer L3
MNR Solutions Pvt Ltd 7.00 to 10.00 Years Bangalore 14 Sep, 2023

Position Network Security Engineer (L3) Experience 7+ Years Notice Period - Immediate Joiners/ Currently se...
firewallcisco meraki

Senior SharePoint Developer
NTT Global Delivery Services Limited 3.00 to 7.00 Years Bangalore 14 Sep, 2023

Developers are the core of everything we create, and your work is instrumental in our success. We strive to be the first firm companies think of when it comes to fulfilling their techno...
sharepointnetjquerypower biweb partsdata servicesui development

Application Consultant ServiceNow
IBM India Pvt Limited 5.00 to 8.00 Years Bangalore 14 Sep, 2023

Introduction IBM Application Consultants work directly with our clients on key initiatives. You will have the opportunity to build an in-depth understanding of their business issues and implement ...
sqlcobolrequirementsenvironmenterpend to end solutionsweb servicesteam buildingdata migrationproblem solvingevent managementdevelopment toolsrelationship building

UI / UX Designer
Alliance Recruitment Agency 1.00 to 3.00 Years Ahmedabad 14 Sep, 2023

We are looking for a dynamic UI/UX designer who will be responsible for the user experience (UX) and user interface (UI) design of our various digital assets. You will ensure that all...
customer relationsresearchdesignvoice of the customeruser experience designsite mapsuser flowsmusic makingflow diagramsuser journeysuser experiencedesign strategyemerging trendsmetrics analysisexperience designbusiness requirementsoptim

Cloud OTM Consultant
LTIMindtree Limited 5.00 to 10.00 Years Pune 06 Sep, 2023

Position Cloud OTM/GTM (Oracle Transportation Management/Global Transportation Management) Experience - 6 to 12 Years Notice period - 0- 45 Days Max Job location - Bangalore Technical Expert...
oracle transportation managementotmgtmcloud gtmfusion gtmcloud otmsaas gtmglobal transportation managementfusion otm

Mechanical Engineer, Trainee Engineer & Site Supervisor
The JSM Engineers 0.00 to 2.00 Years Pune 06 Sep, 2023

Job Details:

Qualification: Deg/Dip/ITI in Mechanical

Location: Jhansi, Pune, Bangalore, Kolkata, Delhi

Salary: 16hidden_mo...
mechanical testingdesign for assemblymechanical engineeringmechanic activitiesmechanical maintenancedesign engineeringfatigue testingmechanical designmechanical behavior of materials

OIG (Oracle Identity Governance) Consultant
LTIMindtree Limited 3.00 to 8.00 Years Nagpur 06 Sep, 2023

Experience: 3 - 12 years Location: All LTIMindtree offices Roles and Responsibilities: Expertise in end-to-end user lifecycle management usin...
oiggovernanceoracle adaptive access manageroracle access manageroimoracle identity manageroracleidamaccessmanager

Tech Architect Magento- Noida
LTIMindtree Limited 12.00 to 17.00 Years Noida 06 Sep, 2023

Key Responsibility: # Designing and leading B2B, B2C, multi-site and multi-country, end-to-end implementations of eCommerce platforms # Contribute effectively in defining the architecture/desi...
magentoarchitect

Azure Architect
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED 10.00 to 15.00 Years Mumbai City 06 Sep, 2023

Short Description:- Primary Responsibilities: Act as the Cloud Architect and owner of multiple large scale, high risk complex projects either on-premises, cloud, or hybrid Interact with the cl...
azurenet

Senior Civil Engineer
BHA FOODS PRIVATE LIMITED 10.00 to 12.00 Years Navi Mumbai 06 Sep, 2023

Senior civil engineers oversee the design and building of large construction projects, including roads, railways, airports, bridges, dams, sewerage systems, pipelines, and buildings seniorcivil engineering designcivilcivil engineering

Cloud OTM Consultant
LTIMindtree Limited 5.00 to 10.00 Years Mumbai City 06 Sep, 2023

Position Cloud OTM/GTM (Oracle Transportation Management/Global Transportation Management) Experience - 6 to 12 Years Notice period - 0- 45 Days Max Job location - Bangalore Technical Expert...
oracle transportation managementotmgtmcloud gtmfusion gtmcloud otmsaas gtmglobal transportation managementfusion otm

OIG OR Identity Governance Specialist
LTIMindtree Limited 5.00 to 10.00 Years Mumbai City 06 Sep, 2023

Expertise in end-to-end user lifecycle management using Oracle Identity Governance. Hands-on development skills are a must on the following:

Installation and Configuration of OIG for I...
governanceoigoracle access manageroimoracle

Fusion PPM Consultant
LTIMindtree Limited 6.00 to 11.00 Years Mumbai City 06 Sep, 2023

Position Fusion PPM (Project Portfolio Management) Experience - 5 to 12 Years Notice period - 0- 45 Days Max Job location - LTIM India offices, Job Summary: We are looking for an experience...
ppmproject portfolio managementfusion project portfolio managementfusion ppmsaas project portfolio managementcloud ppmcloud project portfolio management

OIG (Oracle Identity Governance) Consultant
LTIMindtree Limited 3.00 to 8.00 Years Mumbai City 06 Sep, 2023

Experience: 3 - 12 years Location: All LTIMindtree offices Roles and Responsibilities: Expertise in end-to-end user lifecycle management usin...
oiggovernanceoracle adaptive access manageroracle access manageroimoracle identity manageroracleidamaccessmanager

Jr Graphic Designer - Mumbai- Permanent
PES HR Services 3.00 to 8.00 Years Mumbai City 06 Sep, 2023

We have immediate opening for Jr Graphic Designer Exp : 3+Years Location:Mahalkshmi ,Mumbai (WFO) A leading healthcare company, is seeking a talented and creative Junior Graph...
bannersillustratorinfographicsphotoshopgraphicsindesignmediawebsite

Vice President, Team Lead - Data Engineer, Middle Office Technology
DBS Asia Hub 2 8.00 to 10.00 Years Hyderabad 06 Sep, 2023

* Vice President, Team Lead - Data Engineer, Middle Office Technology Business Function Group Technology and Operations (T&O) enables and empowers the ban...
automationagile methodologiesproject managementquality standardscore bankingwork life balance

Cloud OTM Consultant
LTIMindtree Limited 5.00 to 10.00 Years Hyderabad 06 Sep, 2023

Position Cloud OTM/GTM (Oracle Transportation Management/Global Transportation Management) Experience - 6 to 12 Years Notice period - 0- 45 Days Max Job location - Bangalore Technical Expert...
oracle transportation managementotmgtmcloud gtmfusion gtmcloud otmsaas gtmglobal transportation managementfusion otm

OIG (Oracle Identity Governance) Consultant
LTIMindtree Limited 3.00 to 8.00 Years Delhi 06 Sep, 2023

Experience: 3 - 12 years Location: All LTIMindtree offices Roles and Responsibilities: Expertise in end-to-end user lifecycle management usin...
oiggovernanceoracle adaptive access manageroracle access manageroimoracle identity manageroracleidamaccessmanager

Infrastructure Facility Management
ICICI Bank Ltd 4.00 to 9.00 Years Sitapur 06 Sep, 2023

JobResponsibilities:

Infra Advisor to the Regional Head on all infra related issues in branches

Handling Facilities such as Electrical Maintenance, Repairs &...
maintenancefacility management

Mechanical Engineer, Trainee Engineer & Site Supervisor
The JSM Engineers 0.00 to 2.00 Years Delhi 06 Sep, 2023

Job Details:

Qualification: Deg/Dip/ITI in Mechanical

Location: Jhansi, Pune, Bangalore, Kolkata, Delhi

Salary: 16hidden_mo...
mechanical testingdesign for assemblymechanical engineeringmechanic activitiesmechanical maintenancedesign engineeringfatigue testingmechanical designmechanical behavior of materials

Principal Designer / Senior Designer / Designer - Process
Petrofac Engineering Services India Pvt Ltd 15.00 to 18.00 Years Chennai 06 Sep, 2023

Petrofac is a leading international service provider to the energy industry, with a diverse client portfolio including many of the world s leading energy companies. <...
customer relationsdocumentationgraphic designmaxpresentation skillsproject engineering managementprocess flowflow diagramsenergy supplyprocess safetyenergy securityenergy industrymaterial balanceequipment supplymaterial selectionposition ma

Azure Architect
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED 10.00 to 15.00 Years Chennai 06 Sep, 2023

Short Description:- Primary Responsibilities: Act as the Cloud Architect and owner of multiple large scale, high risk complex projects either on-premises, cloud, or hybrid Interact with the cl...
azurenet

LTIMindtree is hiring for Tech Architect Magento
LTIMindtree Limited 12.00 to 17.00 Years Chennai 06 Sep, 2023

Key Responsibility: # Designing and leading B2B, B2C, multi-site and multi-country, end-to-end implementations of eCommerce platforms # Contribute effectively in defining the architecture/desi...
magentoarchitect

Cloud OTM Consultant
LTIMindtree Limited 5.00 to 10.00 Years Chennai 06 Sep, 2023

Position Cloud OTM/GTM (Oracle Transportation Management/Global Transportation Management) Experience - 6 to 12 Years Notice period - 0- 45 Days Max Job location - Bangalore Technical Expert...
oracle transportation managementotmgtmcloud gtmfusion gtmcloud otmsaas gtmglobal transportation managementfusion otm

Project Cost Controller
Vestas 5.00 to 8.00 Years Chennai 06 Sep, 2023

Professional | Full-Time | Project Portfolio Management Vestas is the world leader in wind technology and a driving force in the development of the wind power industry. Ve...
financecost controlaccountingbeveragereportinginteractive creative directioncontinuous improvement facilitationcash flowerp systemwind energycivil workssocial mediawind turbinestime managementenergy industrypurchase ordersequipment supply

PREV
NEXT

civil designs Job Openings

Mechanical Design Engineer Job Description Template We are looking to hire a talented mechanical design engin... mechanical maintenancemechanical electrical plumbingmechanical designmechanical testing

Chief Engineer Job Description Template We are searching for a chief engineer with excellent leadership abilities to oversee multiple company proj... managementcreativity skillsanalyticalprojectskills.problem-solvingcritical

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Mechanical Design Engineer Job Description Template We are looking to hire a talented mechanical design engin...
mechanical maintenancemechanical electrical plumbingmechanical designmechanical testing

Chief Engineer Job Description Template We are searching for a chief engineer with excellent leadership abilities to oversee multiple company proj...
managementcreativity skillsanalyticalprojectskills.problem-solvingcritical