communications security jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

communications security Job Openings

Showing 15551 - 15600 of 19396 Jobs

Sr Engineer - L2 Network Operations

Tata Communications 3.00 to 6.00 Years Pune 01 Apr, 2024

IPMPLS

BGP

OSPF

Engineer - Technical Support Center

Tata Communications 0.00 to 4.00 Years Pune 01 Apr, 2024

Troubleshooting

Escalation management

SLA management

Communication Skills

Problemsolving

AGM - Demand & Solution Management

Vodafone Idea Limited 11.00 to 15.00 Years Pune 01 Apr, 2024

Area Manager - Mass Retail

Airtel India 5.00 to 9.00 Years Pune 01 Apr, 2024

Ability to lead large teams

Collaborate with internal

external stakeholders

Analytical

problem solving skills

Enterprising

Dotnet Developer

Creospan Private Limited 6.00 to 10.00 Years Pune 01 Apr, 2024

DotNet Fullstack development

cloud technologies

C programming language

NET framework

React

Junior School Admin

The Jain International School 3.00 to 0.00 Years Nagpur 01 Apr, 2024

Administrative Support

Transportation Management

Communication Skills

Accounts Management

Event Organization

IT Administrator

IDS Logic 4.00 to 8.00 Years Noida 01 Apr, 2024

Internet based technologies

Compute

Restaurant General Manager

AppSoft Solutions 0.00 to 4.00 Years Noida 01 Apr, 2024

Job Description

Core Responsibilities Include:

restaurant management

Duty Manager

MILLENNIUM BABYCARES PRIVATE LIMITED 6.00 to 11.00 Years Mumbai City 01 Apr, 2024

facilities management

facility administration

farm management

global product management

PHP Developer

NEUMERIC TECHNOLOGIES PVT LTD 3.00 to 8.00 Years Hyderabad 01 Apr, 2024

Title:PHP Developer

Job Type: Full Time

Location: Dilsukhnagar/Gachibowli, TS

Experience: 3-8 years

Key Responsibil...
mysqlmvcjavascriptdrupalphpwordpressgitnosqlhtml5

Bouncer Needed
B RAJESH KUMAR Hiring For sparkindia 5.00 to 10.00 Years Delhi 01 Apr, 2024

We are searching for a consistently fair Bouncer to regulate patrons access to our bustling establishment. The Bouncer will be required to review prospective clients identification documents, ded...
executive protectionclose protection

Bouncer Needed
B RAJESH KUMAR Hiring For sparkindia 0.00 to 4.00 Years Delhi 01 Apr, 2024

We are searching for a consistently fair Bouncer to regulate patrons access to our bustling establishment. The Bouncer will be required to review prospective clients identification documents, ded...
executive protectionclose protection

Digital Marketing Executive
Inspiretech Realty Pvt Ltd 2.00 to 6.00 Years Noida 01 Apr, 2024

Company Description Inspiretech Realty Pvt. Ltd. is a flourishing Real Estate Consulting firm based in Noida. We specialize in both Residential and Commercial Property in Delhi/NCR. Our mission i...
Social Media MarketingMarketingCommunication skillsWeb Content Writing skillsWeb Analytics proficiencyExcellent writtenverbal communication skills

Content Development
Future Solution Centre 7.00 to 12.00 Years Delhi 01 Apr, 2024

Content development is the process of creating and distributing content for various purposes. Communications technician leads use content development to optimize content for effective search, pub...
contentdevelopmentdevelopment testing

sales and marketing manager
business interface 2.00 to 6.00 Years Delhi 01 Apr, 2024

Regular visits customers- Digital Printers, Paper Converter, Publishing, and Packaging. Generate orders, customer outstanding, travelling outstations. To be responsible for successful delivery ...
marketingsales

sales coordinator
business interface 2.00 to 6.00 Years Delhi 01 Apr, 2024

Regular visits customers- Digital Printers, Paper Converter, Publishing, and Packaging. Generate orders, customer outstanding, travelling outstations. To be responsible for successful delivery ...
salescustomermarketing

Warehouse Manager
MILLENNIUM BABYCARES PRIVATE LIMITED 9.00 to 14.00 Years Delhi 01 Apr, 2024

We are looking for an organized warehouse manager to supervise the receipt, dispatching, and storage of merchandise in our warehouse. The warehouse manager will oversee picking, storage, receivin...
supply chain consultingwarehousingwarehouse operations

Network Support Engineer
AmvionLabs Pvt Ltd, 1.00 to 0.00 Years Chennai 01 Apr, 2024

Job Type: Full-Time Experience Level: Minimum 1 year We are seeking a talented and motivated Network Support Engineer to join our dynamic team. If you have a passion for networking, hands-on exp...
NetworkingNetwork OptimizationTechnical SupportTroubleshootingCapacity PlanningCollaborationFortinet Firewall

Executive Administrative Assistant
MILLENNIUM BABYCARES PRIVATE LIMITED 8.00 to 13.00 Years Chennai 01 Apr, 2024

We are seeking a skilled Executive Administrative Assistant to deliver efficient secretarial and administrative support in a well-organized and timely manner. This role involves working closely ...
co-productionexecutive supportcoordinate meetingssales administrationaccount administrationexecutive productionexecutive correspondencemeeting schedulingsales coordinationadministrativeassistant

Office Assistant & Secretary
MILLENNIUM BABYCARES PRIVATE LIMITED 9.00 to 14.00 Years Chennai 01 Apr, 2024

We are looking for a competent Office Assistant to help with the organization and running of the daily administrative operations of the company. What does an office assistant do The ideal candi...
business analysisordering office suppliesoffice equipment maintenancepersonal assistancesecretarial activitiesadministration managementoffice operationsoffice equipmentexecutive management

Specialist, Contact Centre, Consumer Banking
DBS Bank 5.00 to 8.00 Years Chennai 01 Apr, 2024

Business Function Group Technology and Operations (T&O) enables and empowers the bank with an efficient, nimble and resilient infrastructure through a strategic focus on productivity, quality & c...
Quality ManagementTrainingCustomer ServiceBanking OperationsTeam ManagementProcess ImprovementMS Office ToolsRiskCompliance

Team Lead, Technology, Project Management, Corporate Banking; Lead...
DBS Bank 8.00 to 12.00 Years Chennai 01 Apr, 2024

Business Function Technology and Operations (T&O) enables and empowers the bank with an efficient, nimble and resilient infrastructure through a strategic focus on productivity, quality & control...
Architectural DesignMonitoringLoggingTracingAutomated TestingData ManagementJIRALeadershipCommunicationCollaborationJavaPythonJavaScriptDevOpsAutomationJenkinsSite Reliability EngineeringSRECICDObservabilityAlertingCloud Platforms

Data Analyst (Power BI, Python, SQL)- Internal Audit domain, Bangalore
Talent Leads HR Solutions Pvt Ltd 3.00 to 8.00 Years Bangalore 01 Apr, 2024

Qualification- Mba Finance / Mca Experience 3 years Location Bangalore BO. 5.5 Days working from Office Key responsib...
sqlpowerdata analysisdatapython

Safety Supervisor & Safety Officer
B RAJESH KUMAR Hiring For sparkindia 5.00 to 10.00 Years Bangalore 01 Apr, 2024

Security Operations: Overseeing the day-to-day security operations, including managing security personnel, implementing security protocols, and maintaining a safe environment for guests and employ...
security operations centersecurity architecture designsecurity awareness

Safety Supervisor & Safety Officer
B RAJESH KUMAR Hiring For sparkindia 0.00 to 4.00 Years Bangalore 01 Apr, 2024

Security Operations: Overseeing the day-to-day security operations, including managing security personnel, implementing security protocols, and maintaining a safe environment for guests and employ...
security operations centersecurity architecture designsecurity awareness

Safety Supervisor & Safety Officer
B RAJESH KUMAR Hiring For sparkindia 11.00 to 20.00 Years Bangalore 01 Apr, 2024

Security Operations: Overseeing the day-to-day security operations, including managing security personnel, implementing security protocols, and maintaining a safe environment for guests and employ...
security operations centersecurity architecture designsecurity awareness

Marketing Manager
MILLENNIUM BABYCARES PRIVATE LIMITED 13.00 to 23.00 Years Bangalore 01 Apr, 2024

An Email Marketing Manager utilizes email communication tools to market a company and increase brand awareness. They are experts in the usage of email communications and develop marketing strateg...
marketservicemarketinganalyticscampaignspowerpointcustomerresearchmanagementdigitalprojectntegratedstrong

Content Development
Future Solution Centre 7.00 to 12.00 Years Bangalore 01 Apr, 2024

Content development is the process of creating and distributing content for various purposes. Communications technician leads use content development to optimize content for effective search, pub...
contentdevelopmentdevelopment testing

Senior Azure Engineer
LTIMindtree Limited 8.00 to 12.00 Years Bangalore 01 Apr, 2024

We are hiring for the position ofSenior Azure Engineer at LTI Mindtree Responsibilities

Design and develop Infrastructure as code to deploy Azure r...
azurekubernetessqldevops

Electronics Hardware Engineer
Multispan Control Instruments 1.00 to 4.00 Years Ahmedabad 01 Apr, 2024

Job Description We are seeking an experienced Electronics Hardware Engineer to join our team. The ideal candidate will have a strong understanding of electronics hardware design and a passion for...
Electronics hardware designAnalogdigital circuit designPrototype testinganalysisComponent sourcingEmbedded systems firmware programmingDevelopment of production test specificationsPreparation of bills of materialsPCB layout

Cargo Officer
Prime Placement Vision Pvt Ltd 0.00 to 4.00 Years Vishakhapatnam 30 Mar, 2024

A Cargo Officer, also known as a Cargo Agent or Cargo Handler, is responsible for the efficient handling, processing, and transportation of cargo goods within various modes of transportation, suc...
forwardingcargo managementproject cargocargologisticscargo operations

WFH | Data Entry Typing
Fondstaff Private Limited 0.00 to 3.00 Years Vishakhapatnam 30 Mar, 2024

We have an urgent requirement of Data Entry Operator (Work From Home) who is dedicated and serious about his work. We have various types of online and offline project works. Responsibil...
smswork from home typingpart time work from homework from homepart time freelanceback officeonline data entryonline work from homecomputer operator

Work From Home, Data Entry Operator
Learning Planner 0.00 to 2.00 Years Vijayawada 30 Mar, 2024

We have various types of online and offline project works. We have an urgent requirement of Work From Home, Data Entry Operator who is dedicated and serious about his work. Responsibili...
typing speedwork from homedata entry

WFH | Data Entry Typing
Fondstaff Private Limited 0.00 to 3.00 Years Vijayawada 30 Mar, 2024

We have an urgent requirement of Data Entry Operator (Work From Home) who is dedicated and serious about his work. We have various types of online and offline project works. Responsibil...
smswork from home typingpart time work from homework from homepart time freelanceback officeonline data entryonline work from homecomputer operator

Cargo Officer
Prime Placement Vision Pvt Ltd 0.00 to 4.00 Years Vijayawada 30 Mar, 2024

A Cargo Officer, also known as a Cargo Agent or Cargo Handler, is responsible for the efficient handling, processing, and transportation of cargo goods within various modes of transportation, suc...
forwardingcargo managementproject cargocargologisticscargo operations

Data Entry Typing (Work From Home )
Learning Planner 0.00 to 1.00 Years Vellore 30 Mar, 2024

We are in urgent need of Data EntryTyping(Work From Home Jobs) who is dedicated and serious about his/her work. We have various types of online and offline project works. Responsibiliti...
typing speeddata entry operationms exceltypingms wordwork from home

Aircraft Maintenance Engineer Opening
RENUKA INTERPRISES 0.00 to 4.00 Years Vellore 30 Mar, 2024

We are looking for an experienced Aircraft Maintenance Engineer to join our team and ensure the safety of our aircraft. The aircraft maintenance engineers responsibilities include conducting insp...
aerodynamicstechnical writingaerospace engineeringcreativity skills

Aircraft Maintenance Engineer Vacancy
Divya Staffing Solution 0.00 to 4.00 Years Varanasi 30 Mar, 2024

We are looking for an experienced Aircraft Maintenance Engineer to join our team and ensure the safety of our aircraft. The aircraft maintenance engineers responsibilities include conducting insp...
maintenancecustomer servicehand toolsaircrafts

Project Manager
KINAL GLOBAL CARE PRIVATE LIMITED 1.00 to 6.00 Years Varanasi 30 Mar, 2024

Job description Job Description The Project Manager will be responsible for developing and executing end-to-end project management activities to achieve Global Payroll Organizations program g...
communication skillsdelivery managementscope managementproject managementproject performanceoperational excellenceproject executionoperations improvementproject initiation

Project Manager
KINAL GLOBAL CARE PRIVATE LIMITED 10.00 to 20.00 Years Varanasi 30 Mar, 2024

Job description Job Description The Project Manager will be responsible for developing and executing end-to-end project management activities to achieve Global Payroll Organizations program g...
project initiationproject managementproject executionproject schedulingoperations improvementproject performancecommunication skillsoperational excellencescope management

Logistics Controller
Prime Placement Vision Pvt Ltd 0.00 to 4.00 Years Udaipur 30 Mar, 2024

A Logistics Controller, sometimes referred to as a Logistics Manager or Supply Chain Controller, is responsible for overseeing and managing all aspects of logistics and supply chain operations wi...
reverse logisticsthird-party logisticslogistics coordinationlogistics operationslogistics

Logistics Coordinator
Prime Placement Vision Pvt Ltd 0.00 to 4.00 Years Udaipur 30 Mar, 2024

A Logistics Coordinator plays a crucial role in managing the movement of goods and materials within a company or organization. The job description typically includes a range of responsibilities a...
reverse logisticsthird-party logisticslogistics operationslogistics

Bulk Drugs & API
RELIABLE PLACEMENT SERVICES 1.00 to 6.00 Years Surat 30 Mar, 2024

Urgent | Sales API Products, Email Text: Experience in Lead Marketing, Export Operations , Business development & client relationship management in Domestic & International pharmaceuticals (API S...
marketingbulk drugssales

Data Entry Operator (Part Time & Full Time )
Learning Planner 0.00 to 1.00 Years Surat 30 Mar, 2024

We need some candidates who are interested in working with our company as Data Entry Operator(Part Time & Full Time Jobs) . A serious person who can take on various projects of Data entry project...
data entry work from homedata entrypart timedata entry operationtyping speed

Work From Home, Data Entry Operator
Learning Planner 0.00 to 2.00 Years Surat 30 Mar, 2024

We have various types of online and offline project works. We have an urgent requirement of Work From Home, Data Entry Operator who is dedicated and serious about his work. Responsibili...
typing speedwork from homedata entry

Debt Manager
ICICI Bank Ltd 3.00 to 8.00 Years Surat 30 Mar, 2024

Relationship Manager Debt Service Management Group

Category: Relationship Management ...
debt collectioncollectionsretentionrecoverycollection managementdebt recovery

Computer Operator
Sahast Sales Corporation 12.00 to 22.00 Years Rajahmundry 30 Mar, 2024

We are looking for a talented computer operator to monitor and control our computer systems. As a computer operator, you will be responsible for handling the operation and maintenance of our comp...
computer hardwarecomputer sciencecomputer teaching

Work From Home, Data Entry Operator
Learning Planner 0.00 to 2.00 Years Rajkot 30 Mar, 2024

We have various types of online and offline project works. We have an urgent requirement of Work From Home, Data Entry Operator who is dedicated and serious about his work. Responsibili...
typing speedwork from homedata entry

Logistics Controller
Prime Placement Vision Pvt Ltd 0.00 to 4.00 Years Rajkot 30 Mar, 2024

A Logistics Controller, sometimes referred to as a Logistics Manager or Supply Chain Controller, is responsible for overseeing and managing all aspects of logistics and supply chain operations wi...
reverse logisticsthird-party logisticsforwardingfreight forwardingsupply chain consultinglogisticssupply chain software

Logistics Coordinator
Prime Placement Vision Pvt Ltd 0.00 to 4.00 Years Raipur 30 Mar, 2024

A Logistics Coordinator plays a crucial role in managing the movement of goods and materials within a company or organization. The job description typically includes a range of responsibilities a...
reverse logisticsthird-party logisticssupply chain consultinglotus noteslogisticssupply chain software

PREV
NEXT

communications security Job Openings

Job Description

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers