coordinating hiring activities jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

coordinating hiring activities Job Openings

Showing 30751 - 30800 of 84094 Jobs

Sales Manager

Willpower Consultants Hiring For Axis Max Life Insurance 3.00 to 5.00 Years Gurugram,Delhi, Bangalore, Indore, Chennai, Kurnool, Ujjain, South Goa, North Goa 01 Apr, 2025

Associate Agency Development Manager

marketing

sales

Freelance Recruiter and Intern

KKD Consulting Hiring For KKD 0.00 to 1.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida, Sonipat, Palwal, Mumbai City, Meerut 01 Apr, 2025

Job Title: Freelance Recruiter & Recruitment Intern

Location:

Job Type:

About Us:

calling

screening

Sr HRBP Associate -Gurugram

MEGMA SERVICES 3.00 to 6.00 Years Gurugram 01 Apr, 2025

hr operations

hrbp

associate

Hiring for Field Sales Executive in Delhi NCR

AASAANJOBS PRIVATE LIMITED 1.00 to 5.00 Years Gurugram,Delhi 01 Apr, 2025

Meta Job Description

sales

field sales

sales executive activities

Freshers, Exp - Sales Associates - EV Charger Manufacturer

Avani Consulting 0.00 to 3.00 Years Gurugram 01 Apr, 2025

Company: A leading EV charger manufacturer, revolutionizing the electric vehicle charging ecosystem.

sales coordination

chargers

lithium-ion batteries

battery

Lead Generation Expert

Team Vertex India Global Services Private Limited Hiring For Lead Generation Expert 1.00 to 5.00 Years Gurugram,Delhi 01 Apr, 2025

Job Title:

Location:

Job Summary:

voice process

international call center

Equity Dealer

Apex Services Hiring For One of the leading broking firm 1.00 to 5.00 Years Gurugram,Delhi, Noida, Jaipur, Chandigarh 01 Apr, 2025

Dear Candidate,

Greetings From APEX SERVICES

Role-

EquityDealer

share marketcross sellingthird party productsclient acquisitionequity dealer

E-commerce Account Managment Lead - CBT (Cross Border Trade)
ACUITTY CONSULTANTS LLP Hiring For AcuittyTech 1.00 to 2.00 Years Gurugram 01 Apr, 2025

Key Responsibilities: As an e-commerce account manager, you will work with one of the worlds largest companies to guide their partners ( business-to-businesskey account managementaccountabilitycommunication skillsexport import documentationrelationship buildingms excele-commerce account managementproduct listing

Urgent Hiring For the Position of Relationship Manager and Sales Officer
DREAMS SOLUTIONS 1.00 to 6.00 Years Gurugram,Delhi, Faridabad, Noida 01 Apr, 2025

Dear Candidates Greeting For a day ! We have job opening in Banking Sector for the profile of # Relationship Manager personal loanscasa sales

Manager Hrd
Employee deal consultants Hiring For A Reputed Readymade Garment Export House 15.00 to 25.00 Years Gurugram 01 Apr, 2025

A reputed garment export House is looking for a HR Head. The company has 3 units in Gurugram . HR Officers in all units will be gradualy reporting to him. The opening is based in Head Office and ...
hr compliancelabour lawshr generalist activitieslabour welfare

Marketing Executive
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 14.00 to 24.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Bhagalpur, Hyderabad, Pune, Patna, Guwahati 01 Apr, 2025

Marketing executives coordinate and oversee campaigns geared at promoting products, services, and causes. Marketing executives are adept at a variety of platforms, including print and social med...
marketing researchmarketing communicationmarketing managementbrand managementmarketing

Hiring For Online Marketing Executive (Work From Home Or Office Both) DELHI-NCR
Desnor Destination Pvt Ltd 0.00 to 4.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida 01 Apr, 2025

Dear Candidate Greetings fromDesnor Destination Pvt Ltd ! Job Summary Idealises Internet Marketing Agency is looking for Marketing Executive to join our dynamic team and embark on a rewarding...
marketing planningdigitaldisplay advertisingmarketingfreelancingwork from homemarketing communicationpart time

Phone Banking Officer
EBIXCASH GLOBAL SERVICES PRIVATE LIMITED 0.00 to 1.00 Years Noida 01 Apr, 2025

Payroll Company Name : - Ebixcash Global Services. www.ebixcashglobalservices.com Were hiring Male / Female Fresher and experienced candidates for Ebixcash Process ( Customer ...
tamil speakingtelugukannadatele sales excecutive

Head Admin
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 5.00 to 10.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Pune, Mumbai City 01 Apr, 2025

Main Responsibilities:

Strategic Planning:

Identify opportunities for operational efficiency and cost savings within the administrative functions.

Prepare an...
administration managementoffice operationstravel deskfacility managementfacility operationscorporate administration

Quality Assurance Engineer
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 3.00 to 8.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 01 Apr, 2025

The QA technician role plays an important part in our companys product development process. Our ideal candidate will be responsible for conducting tests before product launches to ensure softwar...
automation testingmanual testingprocessqa analystquality analysttest engineerqualitytestingtest managerqa manager

Lead Maintenance Supervisor
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 3.00 to 7.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Pune, Mumbai City 01 Apr, 2025

Key Responsibilities:

Team Supervision:

Lead, train, and mentor a team of maintenance technicians and staff.

Assign tasks and p...
programmingwellnessinspectionmanagementvalvesschedulingsafety trainingexecutive engineering

German Language Specialist
Wroots Global Private Limited 1.00 to 6.00 Years Gurugram,Jaipur 01 Apr, 2025

Job Title: German Language Specialist International Voice Support Location: Jaipur & Gurgaon voice supportinternational voicecall centre voiceinternational bpogerman translationvoice processcustomer care

Chief Talent Officer
SPENTO PAPERS (INDIA) LLP 25.00 to 0.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City, Itanagar 01 Apr, 2025

We are looking for a Chief Talent Officer who will support our talent acquisition and development activities. You will implement regular performance evaluations and be in charge of our employees...
engagementeeosystemhrispayrolldevelopmentorganizationplanningemployeesuccessionexcellentworkforceinterpersonalstrategic

Management Representative
ALTSEO PRIVATE LIMITED 15.00 to 25.00 Years Gurugram,Delhi, Bangalore, Chennai, Bhagalpur, Hyderabad, Kolkata, Mumbai City, Anantpur, Ahmedabad 01 Apr, 2025

Managers ensure that their assigned department, store, or district is well staffed and provisioned, adheres to quality and service standards, increases revenue and market share, and helps the bus...
qualitycollaborationdecision-makingmanagementcommunicationleadershipproblemsolvingdelegationproject

Business Development Manager
ADITYA BIRLA SUN LIFE INSURANCE COMPANY LIMITED 1.00 to 2.00 Years Gurugram,Delhi, Faridabad, Ghaziabad 01 Apr, 2025

Designation:Agency Manager Education:Any Graduates Experience:Fresher with Good network / Min. 1 Yearin anyDomain Sal...
salesinsuranceagency channelbfsi sales

Hiring AR Caller
Starworth Global Solutions 1.00 to 5.00 Years Gurugram,Noida, Jaipur, Chennai, Pune, Mumbai City 01 Apr, 2025

Hiring AR Caller Location:Pune,Mohali,jaipur,Noida,Gurgaon,Chennai,Trichy Work from office night shift Exp;1-5 years Ctc:max 5.5lpa All Documents must PF Mandatory Immediate Joiner to 15 ...
denialsphysician billingar calling

Brand Manager
MNR Solutions Pvt Ltd 10.00 to 16.00 Years Gurugram 01 Apr, 2025

Brand Manager Key Responsibilities: Develop and execute comprehensive brand strategies and marketing plans, collaborating with the founders to drive brand growth and strengthen market presence...
brand managementbrand marketingbrand planningbrand campaigns

Urgent | Hiring AR Callers
Starworth Global Solutions 1.00 to 5.00 Years Gurugram,Delhi, Pune 01 Apr, 2025

Hiring for AR callers Should have worked in End to End RCM and Denials Specialized in hospital billing and physician billing Experience 1 to 4 years Salary Max upto 45 k Location Mohali and p...
ar follow upar calling

NTT DATA Virtual Drive Hedge Fund Gurgaon
NTT DATA INFORMATION PROCESSING SERVICES PRIVATE LIMITED 1.00 to 3.00 Years Gurugram 01 Apr, 2025

NTT DATA is Hiring experienced candidates for Hedge Fund Accounting domain. Location:Gurgaon Sector 48 (Candor Techspace) Work from Office Only Shift ...
reconciliationhedge fundsnav calculationinvestment banking

Area Sales Manager
SARANSH BIO ORGANIC PRIVATE LIMITED 1.00 to 5.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida 01 Apr, 2025

Visit Doctors and other healthcare professional to promote, sell & demonstrate the Lifestyle healthcare Products

Identifying prospective business opportunities for the company....
business developmentpharmaceutical salesarea sales managementayurvedic medicine

Medical Officer
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 10.00 to 17.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Kochi, Hyderabad, Kollam, Thiruvanananthapuram, Mumbai Ci 01 Apr, 2025

We are seeking a highly capable medical officer to manage our medical team and to supervise the healthcare services that they provide. In this role, your duties will include serving as a clinical...
patient safetydiagnosispatient carecommunication

Medical Officer
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 10.00 to 17.00 Years Kochi,Kollam, Thiruvanananthapuram, Bangalore, Chennai, Noida, Hyderabad, Gurugram, Mumbai City, Del 01 Apr, 2025

We are seeking a highly capable medical officer to manage our medical team and to supervise the healthcare services that they provide. In this role, your duties will include serving as a clinical...
patient safetydiagnosispatient carecommunication

Hiring for Sales Warrior- Kerala
RELIANCE NIPPON LIFE INSURANCE COMPANY LIMITED 1.00 to 6.00 Years Kannur,Kochi, Other Kerala 01 Apr, 2025

RNLIC - Hiring for Kerala Location. All the localite of Kerala - Opportunity for work on on role with RNLIC Direct Marketing Channel ...
agency channelsalesbfsiagencybusinessinsurance sales

Coordinator Backend office work, Home based work
Divine HR Services 0.00 to 1.00 Years Ernakulam,Bangalore, Madurai, Chennai, Hyderabad, Other Madhya Pradesh, Kanyakumari, Pondicherry, Th 01 Apr, 2025

Job Description Dear candidate, Home Based Job& Limited Vacancy Apply Now. J P G TO MS-WORD Data Typing work simply data entry job. Our company hiring every month fresher for typingback officeenglish typingenglish writingback office operationspart timedata entrycomputer operating

Operations Manager
WorkMint 0.00 to 4.00 Years Ernakulam,Idukki, Kannur, Kochi, Kottayam, Malappuram, Palakkad, Pathanamthitta, Thrissur, Wayanad 01 Apr, 2025

WorkMint Hiring For Banking Operations Manager Job Description Supervise and lead a team of banking professionals, providing guidance and support. Monitor and analyze operational perfo...
back officeoperationsbackend operationsback office operationsback office processing

Need Freelancer - Data Entry Operator - Work At Home, Apply Now
VISHWANATH ENTERPRISES 0.00 to 2.00 Years Ernakulam,Thrissur, Chennai, Hyderabad, Vishakhapatnam, Kolkata, Pune, Chandigarh, Hubli, Bhopal 01 Apr, 2025

Dear candidate, We are looking for freshers and experienced candidates for work from home We are offering a Job Part Time Jobs Data Entry Work Online Computer Work Work From Home Back Office Ex...
typing speeddata entrywriting skillspart time

Online Back Office Executive, Data Entry coordinator work
Pick Bright HR Solution 0.00 to 1.00 Years Ernakulam,Idukki, Dehradun, Chennai, Vijayawada, Bhuj, Hyderabad, Chandigarh, Ranchi, Mysore 01 Apr, 2025

Dear applicant, Online data entry jobs is normal typing work. Just require typing speed 30 to 50 wpm. Our company hiring every month fresher for daily online jobs Employment Type: english writingtypingdata entry

Procurement Assistant
SHARMA ENTERPRISES 1.00 to 6.00 Years Ernakulam,Kochi, Kozhikode, Malappuram, Thrissur, Gwalior, Indore, Bokaro, Ranchi, Bhopal 01 Apr, 2025

We are currently searching for a Procurement Assistant supports the purchasing and supply chain processes, assisting with tasks like sourcing suppliers, preparing purchase orders, maintaining pro...
purchase operationssupplier quality assurancesourcing materialsinventory managementrecord maintenancedata analysisrecord keeping

Team Coordinator
SHARMA ENTERPRISES 4.00 to 9.00 Years Ernakulam,Idukki, Kannur, Kasargod, Kochi, Kollam, Kottayam, Kozhikode, Thrissur, Wayanad 01 Apr, 2025

We are looking for a result-driven team leader to be responsible for monitoring and supervising a team of consultants to achieve the organizations objectives and increase sales. You will be respo...
navigationanalysisconflict preventioncommunication skillsproblem solvingleadership managementmanagement reportingcontrolreportingtask completionorganizational administration

Floorman vacancy
Apex Offshore Services 0.00 to 1.00 Years Ernakulam,Idukki, Kochi, Kozhikode, Palakkad, Thrissur, Other Madhya Pradesh, Vishakhapatnam, Kakina 01 Apr, 2025

Greeting Walk-in Interview starts in Mumbai we are hiring for the position of Floormanwith a leading Oil & Gas Industry Job Responsi...
gasdrillingoffshore platformsoildiploma in drilling engineer

Product Manager
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 15.00 to 25.00 Years Ernakulam,Wayanad, Pala, Thiruvananthapuram, Gwalior, Indore, Jabalpur, Bhopal, Ratlam, Sagar 01 Apr, 2025

Job brief We are looking for an experienced Product Manager who is passionate about building products that customers love. You will join a dynamic and fast-paced environment and work with c...
product sourcingproduct marketingproduction engineeringproduct managementproduct manufacturing

3D Visualizer
ED Group Pvt Ltd 1.00 to 5.00 Years Kochi,Other Kerala 01 Apr, 2025

We are hiring! Position: 3D Visualizer Experience: 1-2 years** Location: Kochi, Kerala Only apply if you are proficient using Sketchup, Lumion and D5 Render.* Key Responsibilities: Create hig...
SketchupLumionAutoCAD

Field Marketing Manager
LEADERS GROUP 2.00 to 6.00 Years Kannur,Other Kerala 01 Apr, 2025

Were Hiring: Field Marketing Manager Are you a results-driven marketer who loves on-ground activations and outreach Join our team as a Field Marketing Manager and lead impactful marketing campai...
Offline MarketingEvent ManagementBrand AwarenessLead GenerationTeam ManagementCampaign AnalysisCommunication SkillsRelationship BuildingSponsorship ManagementPartnership BuildingBTL ActivitiesDatadriven

Data Entry Executive work, Do work from home
Aspect Solution 0.00 to 1.00 Years Other Kerala,Nashik, Bangalore, Chennai, Kurnool, Kolkata, Vellore, Mangalore, Other Karnataka, Cudd 01 Apr, 2025

Dear candidate, If you have a passion for data, strong attention to detail, and excellent typing speed, we want to hear from you. J skills needed: basic computer knowledge Position: Fresher /C...
data entryexcelback office

Sr DOTNET Developer (MVC)
TPHRC PVT LTD 7.00 to 11.00 Years Other Kerala,Thiruvananthapuram 01 Apr, 2025

Experience: 7-8 Years Minimum Location: Trivandrum Mode Of work: On Site Responsibilities: Build and maintain application functionality for new and existing systems using the .Net toolset with...
Entity FrameworkSQL ServerHTMLCSSJavaScriptjQueryMVC FrameworkWeb servicesXMLASPNETASPNET CoreEntity Framework CoreREST Web APIs

Financial Controller
GF HOTELS AND RESORTS 10.00 to 14.00 Years Other Kerala 01 Apr, 2025

Responsibilities Maintaining internal controls over financial reporting Presenting financial reports to an executive team Overseeing the preparation of budgets Managing accounting records Eva...
Financial reportingBudget preparationRisk managementRegulatory complianceFinancial statementsFinancial reportsAccounting records managementFinancial data analysisAuditing processes coordination

Sales Executive
MNR Solutions Pvt Ltd 1.00 to 6.00 Years Kochi,Chennai, Lucknow, Navi Mumbai, Vishakhapatnam, Mumbai City, Chandigarh 01 Apr, 2025

Role Description

Develop and execute sales strategies to increase revenue and market share.

Responsible for sales development of microscopes in the region. b2b salessalesmedical equipment salesmedical devices

Urgent hiring for the post of Computer Hardware and Networking Engineer
Karnataka Information Solution 0.00 to 4.00 Years Kochi,Bangalore, Chennai, Hyderabad 01 Apr, 2025

Computer H/w & N/w / System Administration / Desktop Support Qualification : Graduate / Diploma / Under Graduates Job Types : Fres...
network administrationcomputer hardwarehardware networking

Urgent Hiring for Civil Engineer Fresher
Karnataka Information Solution 0.00 to 4.00 Years Kochi,Bangalore, Chennai, Hyderabad 01 Apr, 2025

Description Qualification : BE / BTech Civil Job Types: Full-time, Fresher, Experienced Salary: 25,000.00 - 50,000.00 per month Manage, design, develop, create and maintain projects Conduct o...
civil constructioncivil designconstruction siteconstruction drawingsautocadconstruction safetysite engineeringconstruction estimatingcost estimation

Relationship Manager
CAREER AHEAD 1.00 to 4.00 Years Delhi,Noida, Bangalore, Chennai, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City 01 Apr, 2025

Dear candidate, We are hiring Sales Manager/ Relationship Manager. Experience: 1 year CTC: as per industry standards Location: Pan India
field salesgold valuationbfsi salesgold loan operationsgold loanrelationship managersales managerloan manager

Cluster Head - ADRV Insurance Team Handling Profile Salary Upto 14Lac
Niyukti Management Consultants 10.00 to 17.00 Years Delhi,Noida, Lucknow, Gurugram, Pune, Mumbai City 01 Apr, 2025

We are currently hiring for a key position and would like to share the updated requirements with you. Kindly review the details below: Key Specifications:
insurance agency managementinsurance saleslocation headterritory managerbranch headbranch managerchief branch managerarea manager

Urgent hiring for site supervisor
AASAANJOBS PRIVATE LIMITED Hiring For AASAANJOBS PRIVATE LIMITED 1.00 to 5.00 Years Delhi,Noida, Jaipur, Gurugram, Meerut 01 Apr, 2025

Urgent hiring for Project Executive or Site Supervisor Job Location:- gurgaon, delhi, noida jaipur .kolkata ,meerut Salary:- Up to 22k ESI/PF TA Incentive
design managementproject coordinationproject management

Urgent hiring for Mechanical Engineer Fresher
Jobhunt Consultants Fresher Delhi,Noida, Hyderabad 01 Apr, 2025

Dear Candidate, We have urgent hiring for Mechanical Engineer Fresher in Pan India Location. Qualification- Diploma(Mechanical/Polytechnic/ITI Fitter) Location-Pan India Salary-(12 to 20k)Ac...
service engineeringproduction engineering

Travel Sales Consultant
IMPACT UNIVERSAL XPERTS 1.00 to 3.00 Years Delhi,Gurugram 01 Apr, 2025

US Flight Sales - English 2 Years of exp in Travel Sales (US Flight Sales) Knowledge of GDS ( Amadeus & sabre) Excellenct Communication & Interpersonal Skills Preferably from ...
amadeus gdstravel sales

Data Entry Clerk
APEX TRADING & SOFTECH SOLUTIONS Hiring For APEX TRADING SOFTECH SOLUTIONS 0.00 to 1.00 Years Delhi,Noida, Indore, Hyderabad, Lucknow, Gurugram, Pune, Mumbai City, Vadodara, Bhopal 01 Apr, 2025

Dear candidate, We are looking for freshers and experienced candidates for work from home One of the best opportunity for part time job seekers, it is good opportunity for those, who wants to w...
data entrydata entry operationback office operationscomputer operatingdata entry work from home

PREV
NEXT

coordinating hiring activities Job Openings

About Us:

Job brief We are looking for an experienced Product Manager who is passionate about building products that customers love. You will join a dynamic and fast-paced environment and work with c... product sourcingproduct marketingproduction engineeringproduct managementproduct manufacturing

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Job brief We are looking for an experienced Product Manager who is passionate about building products that customers love. You will join a dynamic and fast-paced environment and work with c...
product sourcingproduct marketingproduction engineeringproduct managementproduct manufacturing