current accunt jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

current accunt Job Openings

Showing 14501 - 14550 of 15627 Jobs

SAFETY OFFICER

PERFECT FMCG PRIVATE LIMITED 0.00 to 4.00 Years Hyderabad 12 Oct, 2023

Job Title:

CONTACT NO:- MISS RIYA (84,333,92,632 ) WHATS APP NO. Company: leadershipsafety regulations procedureshealth safety environment practicesoperations analysis monitoring.

Sr. Sales Officer For Bank
Acura Solutions Hiring For Acura solution 1.00 to 5.00 Years Delhi 12 Oct, 2023

Leading Banks are hiring for Sales Officer uptoSENIOR OFFICER grade Customer Acquisition Role in Banking Sales Division. Location : New Delhi, Agra Product: casacasa salescurrent account

Home Loan Sales officer
HR Desire 0.00 to 2.00 Years Gurugram 12 Oct, 2023

We have opening for Home Loan Sales officer, kindly find the job details below: Mandatory to fill: Tracker

Post Applied for
salesloans

Sales Head
MENTOR MATE HR SERVICES 8.00 to 13.00 Years Delhi 12 Oct, 2023

Role : Head of Sales Qualification: B.Sc. (Chemistry) MBA (Sales & Marketing) Experience : 7 - 15 years Job Location : Saket, New De...
textile industrypharmasalesbusiness-to-businesspaper industry

Salesforce Marketing Cloud Developer or SFMC Developers
HCL Technologies Ltd 5.00 to 10.00 Years Gurugram 12 Oct, 2023

Hi All, Greetings! we are hiring for the below Position at HCL Technologies Pvt Ltd, India Location : Hyderabad/Pune/Noida/Chennai/Bengaluru Primary Skills: Salesforce Marketing Cloud backen...
htmlsalesforce marketing cloudsqlazureampscript

Salesforce Commerce Cloud Lead Developer
HCL Technologies Ltd 5.00 to 10.00 Years Gurugram 12 Oct, 2023

Hi All, Greetings! HCL Technologies Pvt Ltd. India, we are hiring for the below job role Location : Bengaluru/Hyderabad/Chennai/Pune/Noida Primary Skill :B2B Commerce (Cloud Craze) .
<...
lightingvisualforceapex data loadersalesforcearchitectural lighting

Bancassurance & Direct Marketing Opening with Leading Life Insurance Company.
RELIANCE NIPPON LIFE INSURANCE COMPANY LIMITED 1.00 to 6.00 Years Gurugram 12 Oct, 2023

Dear Candidate This is regarding MNC based Life Insurance openings for *BANCASSURANCE*, *DIRECT* ,*AGENCY* & *TELE* channel in *Mumbai-All Region*. Location : Mumbai-All Region/Bangalore/Hydera...
developmentunitinsurancehealthsrmbdmmanager

Accountant
RISEOM TOOL CRAFTS PRIVATE LIMITED 3.00 to 8.00 Years Delhi 12 Oct, 2023

We are seeking trustworthy candidates who work efficiently without sacrificing accuracy. Accountants can expect to work with large amounts of numerical data, handle multiple tasks with deadlines,...
industrycommunicationgoodadaptabilitycollaborationknowledgesummaryskillsefficiencytime-saving

Salesforce Marketing Cloud Developer or SFMC Developers
HCL Technologies Ltd 5.00 to 10.00 Years Noida 12 Oct, 2023

Hi All, Greetings! we are hiring for the below Position at HCL Technologies Pvt Ltd, India Location : Hyderabad/Pune/Noida/Chennai/Bengaluru Primary Skills: Salesforce Marketing Cloud backen...
htmlsalesforce marketing cloudsqlazureampscript

Salesforce Commerce Cloud Lead Developer
HCL Technologies Ltd 5.00 to 10.00 Years Noida 12 Oct, 2023

Hi All, Greetings! HCL Technologies Pvt Ltd. India, we are hiring for the below job role Location : Bengaluru/Hyderabad/Chennai/Pune/Noida Primary Skill :B2B Commerce (Cloud Craze) .
<...
lightingvisualforceapex data loadersalesforcearchitectural lighting

Salesforce Developer with Aura
HCL Technologies Ltd 5.00 to 10.00 Years Noida 12 Oct, 2023

Hi All, Greetings! HCL Technologies Pvt Ltd, India we are hiring for the below job positions. Work Location : Chennai/Hyderabad/Bengaluru/Pune/Noida Exp: 5 Yrs Skill : Salesforce Developers ...
salesforcelightingwebforce.comsfdclightningauralwc

Salesforce Architect or Salesforce Technical Lead
HCL Technologies Ltd 5.00 to 10.00 Years Delhi 12 Oct, 2023

Hi All, Greetings! We are hiring for the below job role in HCL Technologies Pvt Ltd. India Location : Pune/Noida/Hyderabad/Chennai/Bengaluru Role Name: SFDC Lead/SFDC Archite...
force.comapex data loadersfdcsalesforcesalesforce crm

Testing,Software Test Engineer,Test Engineer
AppSoft Solutions 0.00 to 4.00 Years Delhi 12 Oct, 2023

Job Description
Description:

Must be proficient in development environments, debugging tools and source control systems.
platform developmenttestingdesignperformance tuningcontrolfunctional testingtechnical specificationsdebuggingtrend analysissdlcanalysisunit testingload testingunloadingsoftwaresqljavaregression testing

Bancassurance & Direct Marketing Opening with Leading Life Insurance Company.
RELIANCE NIPPON LIFE INSURANCE COMPANY LIMITED 1.00 to 6.00 Years Delhi 12 Oct, 2023

Dear Candidate This is regarding MNC based Life Insurance openings for *BANCASSURANCE*, *DIRECT* ,*AGENCY* & *TELE* channel in *Mumbai-All Region*. Location : Mumbai-All Region/Bangalore/Hydera...
developmentunitinsurancehealthsrmbdmmanager

Opening for the Graphic Designer
T & A Solutions 1.00 to 5.00 Years Chandigarh 12 Oct, 2023

Designation -

Location - Chandigarh

Experience -

Salary - 1.8 -2 LPA

Gender -

Qualification -

Skills -

Target Industry - advertisingadobe photoshopdesignbrochuresphotoshop3ds maxvisual artsdesign briefsaccount executivesemerging technologiesproject administrationmaxctcflashbrandbriefsbusinessprinters

We have opening for Assistant Manager - Credit Cards
Bajaj Finserv Lending Ltd 1.00 to 2.00 Years Chandigarh 12 Oct, 2023

* Duties and Responsibilities - PRINCIPAL ACCOUNTABILITIES 1. Writing content for credit cards on various digital assets 2. Interacting with the marketing and the SEO team to update the current co...
salesmisaccountstatbankingcontent writingcustomer servicecustomer complaintscustomer experienceportfolio marketing

Refinery Operations
AVHAD ENTERPRISES 5.00 to 10.00 Years Chennai 12 Oct, 2023

We are looking to hire a skilled process engineer to oversee the design and implementation of our company processes. As a process engineer, you will be responsible for developing and impl...
chemical testingchemical analysisprocess safety engineeringchemical plantsprocess engineeringchemical researchchemical instrumentationprocess managementchemical process engineering

Bancassurance & Direct Marketing Opening with Leading Life Insurance Company.
RELIANCE NIPPON LIFE INSURANCE COMPANY LIMITED 1.00 to 6.00 Years Chennai 12 Oct, 2023

Dear Candidate This is regarding MNC based Life Insurance openings for *BANCASSURANCE*, *DIRECT* ,*AGENCY* & *TELE* channel in *Mumbai-All Region*. Location : Mumbai-All Region/Bangalore/Hydera...
developmentunitinsurancehealthsrmbdmmanager

BlueYonder Space & Floor Planning Business Architect
Accenture 8.00 to 10.00 Years Chennai 12 Oct, 2023

About Accenture: Accenture is a global professional services company with leading capabilities in digital, cloud and security. Combining unmatched experience and specialized skill...
analyticsbillingbusiness requirementsetllandscapingunix shell scriptingbusiness caseteam managementshell scriptingoracle databasebusiness solutionscategory managementcommunication skillsprofessional servicescustomer requirementstechnical ar

Salesforce Marketing Cloud Developer or SFMC Developers
HCL Technologies Ltd 5.00 to 10.00 Years Chennai 12 Oct, 2023

Hi All, Greetings! we are hiring for the below Position at HCL Technologies Pvt Ltd, India Location : Hyderabad/Pune/Noida/Chennai/Bengaluru Primary Skills: Salesforce Marketing Cloud backen...
htmlsalesforce marketing cloudsqlazureampscript

Salesforce Commerce Cloud Lead Developer
HCL Technologies Ltd 5.00 to 10.00 Years Chennai 12 Oct, 2023

Hi All, Greetings! HCL Technologies Pvt Ltd. India, we are hiring for the below job role Location : Bengaluru/Hyderabad/Chennai/Pune/Noida Primary Skill :B2B Commerce (Cloud Craze) .
<...
lightingvisualforceapex data loadersalesforcearchitectural lighting

Vulnerability Management (CrowdStrike and Qualys)
LTIMindtree Limited 3.00 to 5.00 Years Chennai 12 Oct, 2023

Dear Candidates, We are hiring for the position of Vulnerability Management (CrowdStrike and Qualys) at LTI Mindtree

6 years of Vulnerability Mana...
qualysowaspvulnerability managementrapid7

Wealth Relationship Manager - Bank - Mumbai,Delhi
V-Konnect Associates Hiring For Bank 2.00 to 7.00 Years Bangalore 12 Oct, 2023

Roles and Responsibilities Manages the banking and investments relationship of clients and responsible for overall growth of Liabilities & Investment business from HNI/NRI/UHNI segment. Develops...
portfolio managementmutual funds saleswealth managementlife insurance

Quality Control
Orbitouch Outsourcing Private Limited 4.00 to 9.00 Years Bangalore 12 Oct, 2023

Urgent Hiring ForQuality Control (Only male)||Experience :- 4 years||Location- Medahalli, Bangalore(WFO)||Ctc:-Upto 6 LPA Profile- Quality Control (Only male) Experience :- 4 years Ctc :- Upto...
quality managementquality consultantquality controlquality procurement

RestartWithInfosys-Oracle
Infosys Limited 2.00 to 4.00 Years Bangalore 12 Oct, 2023

This Program is for Women only! Women professionals who are on a career break, currently. These women should have worked for at least 2 years before taking a career break and should have a minimum...
client interfacing skillssoftware configuration managementteam managementproblem solvingsolution designmanagement systemsclient interfacingtechnology solutionsdigital transformationbusiness profitabilityconfiguration managementorganizational in

Manufacturing Domain Consultant - Scrum Master
Infosys Limited 0.00 to 2.00 Years Bangalore 12 Oct, 2023

The Process lead position is responsible for the proper process execution of the development for a designated part of the product portfolio roadmap. The process lead would review current Waters pr...
deliveryreportingaccountinganalyticsautomationproduct life cyclelife science industryiso 9001iso 13485life cyclescrum masterprogram managersproduct portfolioprocess excellenceinterpersonal skillsisoniceagilescrum

opportunity for BSc Frehser_Site/Shift incharge
ADARSH SOLUTIONS PRIVATE LIMITED 0.00 to 1.00 Years Bangalore 12 Oct, 2023

Hi, Candidates with BSC or Diploma in Electrical Designation: Staff Intern or Site Intern Description: In this position you will be learning and working with senior engineers in the field of El...
site inchargeelectrical

ICETS JAVA _ Associate Consultant - Q3
Infosys Limited 1.00 to 9.00 Years Bangalore 12 Oct, 2023

To design and develop the automation tools for quality assurance. Work with internal and external stake holders to gather the requirements and translate the same to highly efficient, scalable and ...
sqljavacustomer relationssapdocumentationuse caseuse caseslife cycledeep learningbusiness casecomputer visionautomation toolsvendor evaluationeffort estimationadvanced analyticstechnology solutionsemerging technologiesdigital transformati

ICETS -PYTHON (AI/ML) Q3 -2023
Infosys Limited 1.00 to 7.00 Years Bangalore 12 Oct, 2023

Infosys Center for Emerging Technology Solutions (iCETS) is the Emerging Technologies solution incubation partner for Infosys clients and service lines. iCETS focuses on incubation of NextGen serv...
front enddeep learningproblem solvingcomputer visionmachine learningservice providersstorage solutionscoding experienceadvanced analyticstechnology solutionsapplication servicesplatform architectureemerging technologiesapplication deployment

DOT NET DEVELOPER BANGALORE
Inspiration Manpower Consultancy Private Ltd 3.00 to 8.00 Years Bangalore 12 Oct, 2023

Job description HiGreetings from Inspiration manpower!This mail is regarding an opening with our Top MNC client. Kindly revert back immediately with an updated resume if it is relevant to you...
graphic designingsoftware development

Production Support Executive for Banglore
Gharondaa Advisors Private Limited 3.00 to 7.00 Years Bangalore 12 Oct, 2023

Job Description **mandatory SN Required Information Details 1 Role** Genesys Production Suppor...
productiongenesys

Project Engineer
Pleasant Inc 2.00 to 3.00 Years Ahmedabad 12 Oct, 2023

Responsible for all maintenance, modifications and new projects (includes civil, mechanical, electrical, instrumentation, etc.) Managing relations with current vendors and add right vendors for ...
inspectionsafetynew projectssitecommissioning

Scrum Master
Online PSB Loans Limited 6.00 to 9.00 Years Ahmedabad 12 Oct, 2023

Scrum Master Qualifications A candidate must possess at least a bachelors degree in computer science or related field to be considered for a Scrum Master job role. Working knowledge of Agile m...
agile methodologyscrum agile development methodology

Sales Executive Manager In Bank
TEKPILLAR 1.00 to 3.00 Years Ahmedabad 12 Oct, 2023

We are looking for a reliable and qualified candidate to join our Sales team as a Field Sales Manager. Your ultimate goal will be to convince the client to purchase products and services offered ...
bankingsalesinsurancemarketingbfsifieldmbaloanfresher

Sales Development Manager
TEKPILLAR 2.00 to 6.00 Years Ahmedabad 12 Oct, 2023

Summary: As a Sales Development Manager, you will oversee a high-performing sales team while increasing client satisfaction and revenue in our flourishing BFSI and insurance divi...
insurancemarketingmanagementsalesbfsileadpaymentfmcg

Area Sales Executive
TEKPILLAR 1.00 to 3.00 Years Ahmedabad 12 Oct, 2023

A CASA Sales Officer is responsible for acquiring and managing Current and Savings Accounts for the bank or financial institution. Their primary focus is on increasing the customer base and ensur...
salesb2b salesdirect salesbankinginsurance salescasa salesfield workb2c salesmarketing

Sales Associate
PRINCETON IT SERVICES PRIVATE LIMITED 2.00 to 7.00 Years Vijayawada 10 Oct, 2023

Job Title: Sales Associate About the Company: Tech365.io - A division of Princeton IT Services is the fastest growing value-added reseller dedicated to bringin...
customer supportcold callingsalestechnical product sales

Cybersecurity Specialist
PRINCETON IT SERVICES PRIVATE LIMITED 2.00 to 7.00 Years Vijayawada 10 Oct, 2023

Job Title: Cybersecurity Specialist About the Company: Tech365.io - A division of Princeton IT Services is the fastest growing value-added reseller dedicated t...
siemfirewallcisspidscismmanagement

Branch Operations Manager
Aanya Placement Services 2.00 to 7.00 Years Vishakhapatnam 10 Oct, 2023

Hiring For Banking :

Branch Operations Manager Jo...
operations managementbranch managementbranch bankingbranch operations

Head Cashier in Dubai
Always International Manpower Service Hiring For Accountant Data Entry Cashier Sales Job in Dubai 1.00 to 5.00 Years Vishakhapatnam 10 Oct, 2023

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Complying with all company,...
cashiersaccount managementsales processaccountingsalesdata analysiscashier activitiesdocument controllogistic regression

Branch Sales Manager - Current Account
AV Global Advisory Services 6.00 to 10.00 Years Vishakhapatnam 10 Oct, 2023

Urgent Vacancy with Leading Bank RoleBranch Sales Manager - Current Account Loca...
current accountbsmcasa

Head Cashier in Dubai
Always International Manpower Service Hiring For Accountant Data Entry Cashier Sales Job in Dubai 1.00 to 5.00 Years Pune 10 Oct, 2023

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Complying with all company,...
cashiersaccount managementsales processaccountingsalesdata analysiscashier activitiesdocument controllogistic regression

Urgent | Casa Sales
BRIGHT IT GLOBAL SOLUTIONS PRIVATE LIMITED Hiring For RM- Casa Sales 1.00 to 6.00 Years Pune 10 Oct, 2023

Dear All, Greetings of the day !! We have an urgent opening for Relationship Manager(CASA SALES) for different Locations, (Hyderabad, Bangalore and Chennai). JD Responibilities :- New to bank...
casa salesmutual fundssaving accountbusiness developmentportfoliowealthcurrent accountforex tradinghni sales

Electrical Engineer
AppSoft Solutions 1.00 to 6.00 Years Pune 10 Oct, 2023

Electrical Engineer Experienced, accomplished, self-motivated Electrical Engineer to maintain and support our industry-leading products and systems. The Electrical Engineer will work across a va...
autocadelectrical maintenancecadelectrical inchargeelectrical officerelectrical design engineer

Bancassurance & Direct Marketing Opening with Leading Life Insurance Company.
RELIANCE NIPPON LIFE INSURANCE COMPANY LIMITED 1.00 to 6.00 Years Pune 10 Oct, 2023

Dear Candidate This is regarding MNC based Life Insurance openings for *BANCASSURANCE*, *DIRECT* ,*AGENCY* & *TELE* channel in *Mumbai-All Region*. Location : Mumbai-All Region/Bangalore/Hydera...
developmentunitinsurancehealthsrmbdmmanager

Oracle SCM Consultant
Infosys Limited 2.00 to 6.00 Years Pune 10 Oct, 2023

A day in the life of an Infoscion As part of the Infosys consulting team, your primary role would be to get to the heart of customer issues, diagnose problem areas, design innovative solutions and...
erpsupply chaincorecustomer relationsinformaticaorder to cashmaster data managementsupply chain managementclient interfacing skillssoftware configuration managementlife cyclemaster datateam managementdata managementproblem solvingsolution d

Sales Development Manager Unit Manager
VELIK HR SOLUTIONS PRIVATE LIMITED 3.00 to 8.00 Years Pune 10 Oct, 2023

Hiring #Hiring Hiring Hiring Profile - Sale Manager, Unit Manager For Locations- Ahmedabad, Baroda, Pune *Life insurance* *Job descript...
life insuranceinsurance

Sales Manager
Radicalmove Consulting Private Limited 2.00 to 7.00 Years Pune 10 Oct, 2023

Dear Candidates Greetings, Profile:Sales Manager Work Location:Delhi-NCR ALL Mega City Experience: 2 to 15 Years sales managementdirect sales

Oil & Gas Consultant
Infosys Limited 2.00 to 6.00 Years Pune 10 Oct, 2023

A day in the life of an Infoscion As part of the Infosys consulting team, your primary role would be to get to the heart of customer issues, diagnose problem areas, design innovative solutions and...
client interfacing skillssoftware configuration managementteam managementproblem solvingsolution designmanagement systemsclient interfacingtechnology solutionsdigital transformationbusiness profitabilityconfiguration managementorganizational in

Cloud OTM Consultant
LTIMindtree Limited 5.00 to 10.00 Years Pune 10 Oct, 2023

Position Cloud OTM/GTM (Oracle Transportation Management/Global Transportation Management) Experience - 6 to 12 Years Notice period - 0- 45 Days Max Job location - Bangalore Technical Expert...
oracle transportation managementotmgtmfusion otmsaas otmcloud gtmglobal transportation managementcloud otmfusion gtm

PREV
NEXT

current accunt Job Openings

CONTACT NO:- MISS RIYA (84,333,92,632 ) WHATS APP NO. Company: leadershipsafety regulations procedureshealth safety environment practicesoperations analysis monitoring.

Job Description

Job description HiGreetings from Inspiration manpower!This mail is regarding an opening with our Top MNC client. Kindly revert back immediately with an updated resume if it is relevant to you... graphic designingsoftware development

Hiring For Banking :

Branch Operations Manager Jo... operations managementbranch managementbranch bankingbranch operations

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Job description HiGreetings from Inspiration manpower!This mail is regarding an opening with our Top MNC client. Kindly revert back immediately with an updated resume if it is relevant to you...
graphic designingsoftware development

Branch Operations Manager Jo...
operations managementbranch managementbranch bankingbranch operations