diesel generators jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

diesel generators Job Openings

Showing 301 - 350 of 367 Jobs

Bancassurance Manager

Skywings Advisors Private Limited 1.00 to 6.00 Years Varanasi 09 Jan, 2024

CTC: Upto 4.25 lpainc rem
Experience: Min 1 Months to 2 year...
insurancebancassurancebanca salesfield salescustomer relationshiplife insurancebanca channel

Relationship Manager - Banca
Skywings Advisors Private Limited 1.00 to 6.00 Years Nellore 09 Jan, 2024

Hiring For a Leading Life Insurance Company for Bancassurance

CTC: Upto 4.25 lpainc rem

Experience: Min 1 Months to 2 year...
insurance saleslife insurancefield salesbanca salesinsurancebancassurancebanca channellife insurance bancali sales

DIRECT HIRING FOR MNC COMPANY
SSG ENTERPRISES Hiring For electrical & electronic engineer Fresher Gurugram 09 Jan, 2024

Dear Candidates MANUFACTURING Bajaj Electricals Ltdis an Indian consumer electrical equipment manufacturing compa...
maintenanceproduction

Electrical Engineer
Garima Interprises Hiring For Garima Interprises 3.00 to 7.00 Years Pune 04 Jan, 2024

Electrical engineers design, develop, and test electrical devices and equipment, including communications systems, power generators, motors and navigation systems, and electrical systems for auto...
customer serviceleadershipcollaborationcommunication skills

Relationship Manager - Banca
Skywings Advisors Private Limited 1.00 to 6.00 Years Ahmedabad 04 Jan, 2024

Dear Candidate,

We are hiring Corporate Agency Manager for Banca Channel.

Graduation is must.

Sales: Accept leads generated from in-branch ...
life insurancecross sellinginsurance salesfield sales

Electrical Engineer
Garima Interprises Hiring For Garima Interprises 3.00 to 7.00 Years Gurugram 03 Jan, 2024

Electrical engineers design, develop, and test electrical devices and equipment, including communications systems, power generators, motors and navigation systems, and electrical systems for auto...
customer serviceleadershipcollaborationcommunication skills

Relationship Manager - Banca
Skywings Advisors Private Limited 1.00 to 6.00 Years Vadodara 31 Dec, 2023

Dear Candidate,

We are hiring Corporate Agency Manager for Banca Channel.

Graduation is must.

Sales: Accept leads generated from in-branch ...
life insurancecross sellinginsurance salesfield sales

Electrical Instrumentation Technician
STEPUP CONSULTANCY 10.00 to 20.00 Years Mangalore 26 Dec, 2023

Electrical instrumentation technicians are responsible for installing, maintaining, and repairing electrical equipment. They commonly work with industrial machinery or other large systems that re...
electrical site engineeringelectrical installationhigh voltageelectricityelectrical designelectrical maintenanceelectrical equipmentelectrical machineselectrician

Iti Electrician
Vijaya Enterprises 2.00 to 3.00 Years Navi Mumbai 21 Dec, 2023

JOB DESCRIPTION

Work experience on H.T., L.T. Panels.

Expert in preventive maintenance of Motors, Starters, and Lighting Distribution.

Conducted ma...
itil certifiediti electrical

Mechanical Engineer
Diksha Upmanyu Hiring For RS ENTERPRISES 9.00 to 14.00 Years Delhi 21 Dec, 2023

A Mechanical Engineer designs machines like generators and engines, including applications such as elevators. They also develop machinery like refrigeration systems for grocery store food storage...
design engineeringmanufacturing analysismechanical maintenancegrocery industrymechanical engineeringelevatorsfood productionmanufacturing engineeringfood manufacturing

Engineer - Electrical
AUTHENTIC ENCON PRIVATE LIMITED 3.00 to 8.00 Years Bangalore 21 Dec, 2023

technical project Execution & Coordination for the electric drive system and consists of the following tasks: - Understand Input documents like Client Specs, Layout & drawings, international & n...
sapstandardscommunication skills

Financial Planning Executive
SUPRO INFO SOLUTIONS PRIVATE LIMITED 1.00 to 6.00 Years Chennai 19 Dec, 2023

CTC- As Per Location Channel- Direct Age Limit- 21 to 38 Education- Min Graduation Experience- Min 2 years of Banking (BFSI) Sales Experience with Field work - Lead Based Work - Branch Sal...
bfsirelationshippharmasalesbusiness developmentfield salesmarketingmedical representative

ST Electrical
ValueDrive Technologies Pvt Ltd 7.00 to 10.00 Years Chennai 13 Dec, 2023

ST Electrical Criteria

Qualification minimum ITI, Diploma in Automobile or Diesel Mechanic or 10th Pass but

good experience.

Minimum ...
car repairdiplomamaintenancerepairautomobilevehicleinstallationtechniciancarelectricianmechanicvehicle management repairs

Customer Support Engineer
Efficiencie tech solutions LLP 6.00 to 10.00 Years Bangalore 13 Dec, 2023

Dear Candidate, We are Hiring
Customer Support Engineerfor Bangalore Location
Experience : 6 - 10year Notice Period : Immediate - 30days
Requ...
network operationscustomer supportip networking

Electrical Engineer
Vibgyor Enterprises Hiring For Electrical Site engineering 5.00 to 10.00 Years Hyderabad 11 Dec, 2023

We are having an urgent requirement for aElectrical Engineer Or Electrical Site Engineerrole. Domain: PharmaceuticalProducts Manufacturing Experience:-5 Yrs. ...
electrical designelectrical maintenanceelectrical installationelectrical site engineeringiti electricalelectrical engineerelectrical technician

Assistant Manager - Technical Services (Chemical Synthesis)
BASF 5.00 to 10.00 Years Navi Mumbai 08 Dec, 2023

Objectives: Independently execute lab work for identified projects. Knowledge on processes used in Textile and Leather industry value chain. Generate application know how of products. Visit cu...
PolymersBiocidesChemical synthesisAlkylationInnovationCustomer FocusKnowledge in SurfactantsTextile formulationsEsterificationPolymer manufactureFries rearrangementDehydration reactionsAromatic substitutionHydrolysis reactionsProduct isolati

Business Development Manager
Skywings Advisors Private Limited 1.00 to 6.00 Years Ludhiana 08 Dec, 2023

Dear Candidate , We hiring for Life Insurance Company (Bancassurance Channel). Job description: - Sales: Accept leads generated from in-branch lead generators as well as warm leads provided by...
bancassurancelife insurancebancasurancebancabanka assurance

ST Electrical
ValueDrive Technologies Pvt Ltd 7.00 to 10.00 Years Gurugram 08 Dec, 2023

Dear Candidate, Greetings from Spinny.! Job Title: ST-Electrical Location: Delhi NCR / Gurugram ...
vehicleinstallationcar repairautomobilediplomamechanictechniciandiselelectricianrepair maintenancecar

Electrical Engineer
STEPUP CONSULTANCY 3.00 to 8.00 Years Hyderabad 06 Dec, 2023

As an electrical engineer you will be responsible for ensuring the smooth running of services such as lighting, heating, and ventilation. Duties could include working at heights or with power gen...
electrical equipmentelectronicselectrical industryelectrical engineeringelectrical maintenancespectrum analyzersignal generators

Python - Network Automation and CPE Tester
Infosys Limited 2.00 to 4.00 Years Bangalore 04 Dec, 2023

A day in the life of an Infoscion As part of the Infosys consulting team, your primary role would be to get to the heart of customer issues, diagnose problem areas, design innovative solutions and...
client interfacing skillssoftware configuration managementteam managementproblem solvingsolution designtest automationstability testingnetwork managementmanagement systemsclient interfacingworking experiencetechnology solutionsdigital transfor

Python - Network Automation and CPE Tester
Infosys Limited 6.00 to 8.00 Years Bangalore 04 Dec, 2023

A day in the life of an Infoscion As part of the Infosys consulting team, your primary role would be to lead the engagement effort of providing high-quality and value-adding consulting solutions t...
strong business acumenclient interfacing skillssoftware configuration managementteam managementproblem solvingsolution designtest automationbusiness acumenchange managementstability testingnetwork managementmanagement systemsclient interfacing

Python - Network Automation and CPE Tester
Infosys Limited 0.00 to 1.00 Years Bangalore 04 Dec, 2023

A day in the life of an Infoscion As part of the Infosys consulting team, your primary role would be to actively aid the consulting team in different phases of the project including problem defini...
problem solvingtest automationvendor evaluationeffort estimationstability testingnetwork managementworking experiencetechnology solutionsdigital transformationnetwork troubleshootingorganizational initiativesrequirement specificationsfitvoip

NPD and process engineer for a manufacturing company
Career Solutions Hiring For 8295842337 10.00 to 20.00 Years Delhi 01 Dec, 2023

We Required NPD and process engineer for a manufacturing company Qualification- Any electronics or mechtronics Exp- min 10 yrs Salary- Upto 15 lacs Location- Kundli, sonipat ____________________...
plasticssignal generatorsnew product developmentelectronicsnpd

Data Scientist - Business Intelligence
BOYEN HADDIN CONSULTING AND TECHNOLOGY PRIVATE LIMITED 2.00 to 6.00 Years Bangalore 01 Dec, 2023

Good theoretical understanding of statistics and probability - includes hypothesis testing, different probability distributions (both discrete and continuous), fundamental theorems such as Weak l...
data engineeringbusiness intelligence

Senior Relationship Officer
Skywings Advisors Private Limited 2.00 to 6.00 Years Vishakhapatnam 27 Nov, 2023

JOB DESCRIPTION: Company;Canara hsbc Work closely & jointly with Banc assurance channel partner to ensure CHL achieves its business aspiration in line with the AOP Targets (New & Customer Reten...
salestarget achievementbancassurance salesbusiness developmentinsurancelife insurance

Senior Relationship Officer
Skywings Advisors Private Limited 2.00 to 6.00 Years Vijayawada 20 Nov, 2023

JOB DESCRIPTION: Company;Canara hsbc Work closely & jointly with Banc assurance channel partner to ensure CHL achieves its business aspiration in line with the AOP Targets (New & Customer Reten...
salestarget achievementbancassurance salesbusiness developmentinsurancelife insurance

DIRECT HIRING FOR MNC COMPANY IN EE & EEC ENGINEER
SSG ENTERPRISES Hiring For ELECTRICAL & ELECTRONICS ENGINEER 0.00 to 1.00 Years Gurugram 20 Nov, 2023

Dear Candidates MANUFACTURING electrical equipment manufacturing company based in Mumbai, Maharashtra. It is a p...
quality engineeringproduction engineering

ST Electrical
ValueDrive Technologies Pvt Ltd 7.00 to 10.00 Years Delhi 20 Nov, 2023

Dear Candidate, Greetings from Spinny.! Job Title: ST-Electrical Location: Delhi NCR / Gurugram ...
vehicleinstallationcar repairautomobilediplomamechanictechniciandiselelectricianrepair maintenancecar

Lead Generation Executive
Jobs Territory Hiring For Fuel Delivery 2.00 to 3.00 Years Gurugram 07 Nov, 2023

Dear Candidate, There is a urgent opening for Lead Generation in the companny Fuel Delivery . They are into providing diesel to big housing societies, hospitals, malls etc. to be used in gene...
direct salessalestelecallingcold calling

Datacom Protocol Design and Development Software Defined Access Networks
Nokia Solutions and Networks India Pvt Ltd 4.00 to 9.00 Years Chennai 06 Nov, 2023

About Nokia At Nokia we create the technology to connect the world. Developing and delivering the industrys only end-to-end portfolio of network equipment, software, services and licen...
problem solvingtest casesaccess networkslayer 3software development life cyclelayer 2wireless access

ST Electrical
ValueDrive Technologies Pvt Ltd 7.00 to 10.00 Years Gurugram 04 Nov, 2023

Dear Candidate, Greetings from Spinny.! Job Title: ST-Electrical Location: Delhi NCR / Gurugram ...
vehicleinstallationcar repairautomobilediplomamechanictechniciandiselelectricianrepair maintenancecar

Senior Engineer - Mining Support
Cummins India Ltd 0.00 to 4.00 Years Bhubaneswar 02 Nov, 2023

*Technical specialist and primary customer support contact to diagnose and execute complex repairs to engine products at the customer s site.
Establishes and continually develops productive cus...
safetycommissioningsiteinspectiontroubleshootingservice workfuel systemsfield servicedata managementsite managementbusiness systemexport controlscustomer supportbusiness systemsmanagement systemproduct knowledgeservice managementmechanica

Industrial Electrician
M/S B NANDI 5.00 to 10.00 Years Hyderabad 30 Oct, 2023

Industrial electricians install, maintain, test, troubleshoot and repair industrial electrical equipment and associated electrical and electronic controls. They are employed by electrical contrac...
industrial designsystemscircuitsfixturesindustrialtoolscontrolwiringinstallingreplacingoutmillelectricalschematicselectricianequipmenlayingdefectiveknowing

Service Engineers
Prominent Consultant 5.00 to 10.00 Years Other Assam 26 Oct, 2023

Service Engineers
Job description should have exp in commissioning & servicing of mobile equipment/ Construction Equipment Exp of multiple systems like hydraulic controls i...
diesel enginesservice engineers

Deputy Manager-Customer Project
Schneider Electric 5.00 to 10.00 Years Jaipur 26 Oct, 2023

*

Critical Facility Manager Overview

The CFM supervises a team of technicians that are engaged in mission critical facility infrastructure systems Operations and ...
miscustomer servicedocumentationfinanceinsurancepeople management skillsms officeups systemscost controlit operationsteam buildingpower systemscooling towersquality controlcritical systemsmission criticalpeople managementmanagement skills

Area Sales Manager
SKILLLABS RESOURCE SERVICES PRIVATE LIMITED 4.00 to 9.00 Years Hyderabad 20 Oct, 2023

JOB PURPOSE: - To generate Business Loan (Self Employed & Self Employed Professional) business and to achieve on monthly basis benchmark targets and meet SM productivity norms set basis Grade/Ba...
personal loanscommercial lendingsmall business lendingauto loans

urgent Hiring Truck Driver for noida Location
VELIK HR SOLUTIONS PRIVATE LIMITED 1.00 to 6.00 Years Noida 18 Oct, 2023

Urgent Hiring Truck Driver for Noida Location Position:- Truck Driver- Company:- AA India Pvt. Ltd., Noida. Descri...
truck drivingdriversheavy truck driverheavy driver

Deputy Manager-Customer Project
Schneider Electric 5.00 to 10.00 Years Chandigarh 18 Oct, 2023

*

Critical Facility Manager Overview

The CFM supervises a team of technicians that are engaged in mission critical facility infrastructure systems Operations and ...
miscustomer servicedocumentationfinanceinsurancepeople management skillsms officeups systemscost controlit operationsteam buildingpower systemscooling towersquality controlcritical systemsmission criticalpeople managementmanagement skills

Content Design Dev-Ops
IBM India Pvt Limited 0.00 to 4.00 Years Kochi 12 Oct, 2023

Introduction At IBM, work is more than a job it s a calling: To build. To design. To code. To consult. To think along with clients and sell. To make markets. To invent. To collaborate. Not just to...
software development life cyclesoftware development toolsfront endbash scriptingcontent designagile developmentdevelopment toolsdigital conversionsoftware developmentsoftware engineeringintellectual propertywritten communicationstrategic initi

Auto Electrician
SOFOMATION ENERGY CONSULTANTS PRIVATE LIMITED 4.00 to 9.00 Years Chennai 12 Oct, 2023

Inspect, troubleshoot, disassemble, service, rebuild, overhaul, and repair electrical systems an subassemblies outfitted to a variety of heavy vehicles.

Ensure that all heavy v...
vehicleheavyheavy machineryauto

Auto Electrician
SOFOMATION ENERGY CONSULTANTS PRIVATE LIMITED 4.00 to 9.00 Years Hyderabad 06 Oct, 2023

Inspect, troubleshoot, disassemble, service, rebuild, overhaul, and repair electrical systems an subassemblies outfitted to a variety of heavy vehicles.

Ensure that all heavy v...
vehicleheavyheavy machineryauto

Service Manager- Pune
ALPAULS ENTERPRISES (PROP ALDESION M POYYAKARAN) 7.00 to 12.00 Years Pune 04 Oct, 2023

company isdirect dealer of the biggest providingSales & Service Support for 1000, 2000, 3000, 4000, T 200 & T 300 Series of Automatic transmission having facility of Maintenance and Overhauling. ...
breakdown maintenancecontrol panel

Regional Sales Manager, Area Sales Manager - Home Loans, LAP
AV Global Advisory Services 10.00 to 15.00 Years Hyderabad 04 Oct, 2023

Urgent Vacancy with Leading Bank Role - Regional Sales Manager/Area Sales Manager - Home Loans/LAP Location - Chennai, Hyderabad, Bangalore

Sourcing of Home Loan, Loan against Proper...
mortgagehome loanslap

Req. for the post Sr. Engineer - Calibration
Mahindra business & consulting services pvt ltd 4.00 to 5.00 Years Chennai 04 Oct, 2023

Responsibilities & Key Deliverables - Responsible for execution of - steady state calibration development, vehicle level comfort functions, emission regulations for Dies...
steady stateengine calibrationvehicle managementtcpftrcafefleettestsplanninganalysisaltitudeengineersmanagementautomotiveanalyticalvalidation

Calibration Engineer AirSystem_Pune
Bosch Group 5.00 to 7.00 Years Pune 03 Oct, 2023

Job Description BE, M.Tech (Mechanical, Automobile). 5-7 years of relevant work experience. Experienced in technically leading / working on calibration development projects Experience in calib...
calibrationmechanicalisonabldocumentationengine management systemsmanagement systemsprofessional mannerpidincaetassoundtestingcontrolclimatebusinessmanagementcomponentspowertrain

Applications invited for General Manager / Chief Engineer (Electrical) at APMD
Amity University 5.00 to 14.00 Years Noida 03 Oct, 2023

Applications invited for General Manager / Chief Engineer (Electrical) at APMD - 12-10-2022 - Adv/AUUP/HR/21/093 Advertisement Date: 12-10-2022 Adv/AUUP/HR/21/093 AMITY UNIVERSITY We at Amity Powe...
mechanicalsafetymachineryhvacplumbingair conditioningpower managementcommunication skillsverbal communicationelectrical engineeringpansolarsoundresumeengineersmanagement

automobile Technical Advisor
Roche International Hiring For Automobile Industry 1.00 to 2.00 Years Navi Mumbai 02 Oct, 2023

JOB DESCRIPTION FOR TECHNICAL ADVISOR: RESPONSIBILITES Technical Advisor Technical Advisors are responsible for quality of work through diagnosis of custome...
technical advisorytechnician activitiesautomobile

Auto Electrician
SOFOMATION ENERGY CONSULTANTS PRIVATE LIMITED 4.00 to 9.00 Years Bangalore 02 Oct, 2023

Inspect, troubleshoot, disassemble, service, rebuild, overhaul, and repair electrical systems an subassemblies outfitted to a variety of heavy vehicles.

Ensure that all heavy v...
vehicleheavyheavy machineryauto

Python - Network Automation and CPE Tester
Infosys Limited 6.00 to 8.00 Years Bangalore 02 Oct, 2023

A day in the life of an Infoscion As part of the Infosys consulting team, your primary role would be to lead the engagement effort of providing high-quality and value-adding consulting solutions t...
strong business acumenclient interfacing skillssoftware configuration managementteam managementproblem solvingsolution designtest automationbusiness acumenchange managementstability testingnetwork managementmanagement systemsclient interfacing

Python - Network Automation and CPE Tester
Infosys Limited 0.00 to 1.00 Years Bangalore 02 Oct, 2023

A day in the life of an Infoscion As part of the Infosys consulting team, your primary role would be to actively aid the consulting team in different phases of the project including problem defini...
problem solvingtest automationvendor evaluationeffort estimationstability testingnetwork managementworking experiencetechnology solutionsdigital transformationnetwork troubleshootingorganizational initiativesrequirement specificationsfitvoip

PREV
NEXT

diesel generators Job Openings

Customer Support Engineerfor Bangalore Location

Requ... network operationscustomer supportip networking

Job description should have exp in commissioning & servicing of mobile equipment/ Construction Equipment Exp of multiple systems like hydraulic controls i... diesel enginesservice engineers

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Requ...
network operationscustomer supportip networking

Job description should have exp in commissioning & servicing of mobile equipment/ Construction Equipment Exp of multiple systems like hydraulic controls i...
diesel enginesservice engineers