Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
Responsibilities & Key Deliverables 1) Define test strategy by exploring, identifying, evaluating and institutionalizing the tools and test equipment 2) Defining the test arch...
miscustomer servicedocumentationfinanceinsuranceembedded software testingqa testingtest strategysystem softwaretest automationsoftware testingembedded softwareelectronics engineeringEaton India Innovation Centre: Eaton India Innovation Center (EIIC) in Pune, is an integral part of Eaton s global engineering and technology footprint and house one third of Eaton s i...
mechanicalsafetymachineryhvacplumbingboard of directorssupply chain managementcontinuous improvement facilitationlife cyclesupply chainhuman rightssalesmarketingJob Description Experience in System Testing/Software Testing for Automotive/Embedded Products Working experience with dSpace or Vector tool chains like Control Desk, Automa...
testing processcommercial modelsautomotive safetysystem requirementssoftware developmentJob Description GeneralSkills
Job Description This job is to address testing requirements of global customer projects. The incumbent joining the Global Test Team is expected to work in the areas of Automotive controllers (Power t...
test casesfunctional testingregression testingfunctionaldebuggingrational clear questtest automation frameworktest executiontest automationdefect reportingJob Description Responsible for developing models for hardware in loop testing.
Experience in System Testing/Software Testing for Automotive/Embedded Products Working experience with dSpace or Vector tool chains like Control Desk, Automation Desk, Plant ...
testing processcommercial modelsautomotive safetysystem requirementssoftware developmentscmalmecuudssillinrqmtptcanoevectordspacetestingcontrol
Education BE/ME - Electronics, Computer Science Experience 2-5years Job Responsibilities Responsibilities
Job Description 1. Experience in HIL tests , SW / system testing in Automotive Domain ( knowledge of dSpace / vector test systems preferred ) 2. Thorough knowledge in Analysis of the requirements, T...
test systemstest strategysystem testingcustomer handlingtestspythonResponsibilities & Key Deliverables 1) Define test strategy by exploring, identifying, evaluating and institutionalizing the tools and test equipment 2) Defining the test arch...
miscustomer servicedocumentationfinanceinsuranceembedded software testingqa testingtest strategysystem softwaretest automationsoftware testingResponsibilities & Key Deliverables 1) Define test strategy by exploring, identifying, evaluating and institutionalizing the tools and test equipment 2) Defining the test arch...
miscustomer servicedocumentationfinanceinsuranceembedded software testingqa testingtest strategysystem softwaretest automationsoftware testingembedded softwareelectronics engineeringResponsibilities & Key Deliverables 1) Define test strategy by exploring, identifying, evaluating and institutionalizing the tools and test equipment 2) Defining the test arch...
miscustomer servicedocumentationfinanceinsuranceembedded software testingqa testingtest strategysystem softwaretest automationsoftware testingResponsibilities & Key Deliverables 1) Define test strategy by exploring, identifying, evaluating and institutionalizing the tools and test equipment 2) Defining the test arch...
miscustomer servicedocumentationfinanceinsuranceembedded software testingqa testingtest strategysystem softwaretest automationsoftware testingResponsibilities & Key Deliverables 1) Define test strategy by exploring, identifying, evaluating and institutionalizing the tools and test equipment 2) Defining the test arch...
miscustomer servicedocumentationfinanceinsuranceembedded software testingqa testingtest strategysystem softwaretest automationsoftware testingResponsibilities & Key Deliverables 1) Define test strategy by exploring, identifying, evaluating and institutionalizing the tools and test equipment 2) Defining the test arch...
miscustomer servicedocumentationfinanceinsuranceembedded software testingqa testingtest strategysystem softwaretest automationsoftware testing* Roles and Responsibilities:
Do you enjoy working with Autonomous Systems of Automated Driving If yes, We are looking for extra ordinary talent with passion for innovation and quality and having ability to demonstrate high stand...
open sourcerostechnical designartdesign specificationsmachine learningsoftware validationawstest designoperating systemsapplication deploymentembedded softwaretechnical presentationsautomation toolsautomotive productstechnical analysistestDo you enjoy working with Autonomous Systems of Automated Driving If so, We are looking for talented, hardworking engineer passionate about Automotive Software quality and having ability to demonstra...
open sourcetechnical designartdesign specificationsmachine learningsoftware validationawstest designoperating systemsapplication deploymentembedded softwaretechnical presentationsautomation toolssoftware qualitytechnical analysistest proCyient is a global engineering and technology solutions company. As a Design, Build, and Maintain partner for leading organizations worldwide, we take solution ownership across the value chain to help...
architectural designtechnology solutionsregulatory requirementsadvanced analyticssalesasmdeliveryumlcustomer relationsisojavaembedded cproposal writingfunctional safetybdmglobal engineeringDescription: If you desire to be part of something special, to be part of a winning team, to be part of a fun team winning is fun. We are looking forward to an Engineering Manager S...
embedded systemsisopower managementsafetydocumentationcommissioningsoftware development life cyclepreventive maintenancesoftware designquality toolsmonte carlotech lead software qualification v&v test engineer in pune Role: Tech Lead Software Qualification V&V Test Engineer Qualif...
test casesreportingregression testingautomationjavatest automation toolslife cycleroot causetest scriptstest strategytest automationsoftware testingautomation tools* Job Responsibilities: Develop real time Simulation Models using Mat lab/Simulink in support of real time testing of integrated controllers using Hardware-In-the-Loop (HIL) Integration of plant mo...
risk managementhardware designsoftware testingmodel developmentknowledge sharingproject managementcommunication skillsinventory managementEssential: 1. Knowledge on conventional powertrain such as Diesel, Gas and Hybrid systems 2. Creating and managing Test Cases(DVPs) which includes maintaining tra...
automationscriptscanalyzergasincaartifactsvalidationsimulationissue managementhildspacehardwarepowertrainpropulsionmanagement systemdiagnosticstest automationtest scriptsmanagementdieselIf you desire to be part of something special, to be part of a winning team, to be part of a fun team winning is fun. We are looking forward to Senior Engineer - Controls based in Pune, Indi...
safetycommissioningsiteinspectiontroubleshootingibm rationalglobal teamsproduct designcode generationembedded systemspower managementmonte carloDescription: If you desire to be part of something special, to be part of a winning team, to be part of a fun team winning is fun. We are looking forward to an Engineer based in...
new product developmentsix sigmaequipment supplypower electronicsenergy efficiencypower distributionsystem engineeringproduct developmentbehavioral trainingsystem architecturesystems engineeringinterpersonal skillsDescription: If you desire to be part of something special, to be part of a winning team, to be part of a fun team winning is fun. We are looking forward to a Lead Engineer (XiL)basedi...
javacustomer relationslinuxautomationsoftware development life cyclelife cycledefect trackingbusiness systemtest automationtest procedurespower managementDescription: If you desire to be part of something special, to be part of a winning team, to be part of a fun team winning is fun. We are looking forward to a Lead Engineer Controls...
linuxautomationcustomer relationselectronics hardware designjavapower managementsystem softwareembedded systemshardware designteam developmentelectric vehiclemonte carloDescription: If you desire to be part of something special, to be part of a winning team, to be part of a fun team winning is fun. We are looking forward to a Specialists Core ...
electronics hardware designembedded software developmentdevice drivershardware designsystem softwareaction orientedemerging trendsembedded systemspower managementteam development *
Areas of Work: Analysis and implementation of CAN/LIN/Flexray/Automotive Ethernet for HIL environment.
Creation, Upgradation and Maintenance of Automation tools.
, *
Required Skills/Knowledge:
experience in embedded controller networks (CAN, LIN) and the use of ECU diagnostic and network communication tools to verify and troubleshoot distributed vehicle systems (e.g. CANoe, CANalyzer, Vehic...
test casesreportingregression testingautomationjavasoftware quality assurancetest executionvehicle testingtest proceduressoftware testingsoftware qualityquality assuranceembedded softwarefunctional safetytest environmentscommunication skillexperience in embedded controller networks (CAN, LIN) and the use of ECU diagnostic and network communication tools to verify and troubleshoot distributed vehicle systems (e.g. CANoe, CANalyzer, Vehic...
test casesreportingregression testingautomationjavasoftware quality assurancetest executionvehicle testingtest proceduressoftware testingsoftware qualityquality assuranceembedded softwarefunctional safetytest environmentscommunication skillDUTIES AND RESPOSIBILITIES:
* SW ArchitectDomainAutomotive : Program Manager - EE Component Responsibility : Daimler Trucks and BussesResponsibilitiesLead the team which is responsible for Body Control EE Component development f...
systems engineeringchange requestsframeworkproblem solvingjavascriptfunctional safetyproject managementsoftware developmentlinuxstatus trackingwiring harnessgerman languagejavaQualifications: Education Bachelors or Master s Degree in Computer Science/Electrical & Electronics/ Masters in Computer Applications, Control Systems 8-14 years of experience in Sof...
javalinuxjavascriptframeworktest automation frameworkroot causehil testingvisual basicskill matrixtesting toolstest scenarioscost effectiverisk managementhardware design
Dear Candidate, Were Opening forAutomotive Test Engineer for Automation Roles & Responsibilities :- Profile: Automotive Test Engineer for automation Mandatory Skills experience in embedded controll...
lincantmmiasqembeddedistqbspicenetworkscontrollerDear Candidate, Were Opening forHIL Profiles - Customer 2 Roles & Responsibilities :- Source profile with Skillset :- HIL for customer 2 Tool exper...
transmissionpowertrainetas labcardspace control deskDear Candidate, Were Opening forHIL Test Engineer Roles & Responsibilities :- Minimum of 3 to 5 years of experience with embedded controls developme...
dspace control deskdspace automation deskecu test toolDear Candidate, Were Opening forHIL/ADAS/System Testers Roles & Responsibilities :- Experience in Automotive Domain (Gasoline & Diesel Engine Management, Electrical Vehicle System, Advanced Driver A...
dspacecanoeperlcanalysercapl programmingtptpythonlabcarecu testDear Candidate, Were Opening forAutomotive Test Engineer for Automation Roles & Responsibilities :- Profile: Automotive Test Engineer for automation Mandatory Skills experience in embedded controll...
lincantmmiasqembeddedistqbspicenetworkscontroller
Job Description Worked in Steering/Power train/Brakes/Transmission domain Model based SW development using MATLAB Simulink/ DSpace Target Link/ ASCET Strong development experience in embedded C Wo...
data acquisitionembedded designdriver developmentconfiguration managementprotocolsadcuartcontroldspaceautosarchange managementumlmatlabrequirements managementembeddedisodesignspiJob Description Good knowledge on System Testing concepts, test case design and V&V models. Experience in defining and execution of Test Cases with techniques.
Job Description This job is to address testing requirements of global customer projects. The incumbent joining the Global Test Team is expected to work in the areas of New Energy Vehicle (NEV...
test automation frameworktest executiontest automationdefect reportingequipment supplymanagement systemautomation frameworkKey skills required for the job are: n HIL Validation Engineer - Job Responsibilities Plant model development and configuring Communication protocols using Matlab / Simulink & dSPACE libraries Write t...
test casesmodel developmenthil testinghiltest scriptstest executionlinfittraceability matrixcanoebusdefect reportingcommunication protocolsudstest strategycommercial modelsrtwsystem requirementsDescription: If you desire to be part of something special, to be part of a winning team, to be part of a fun team winning is fun. We are looking forward to an Engineer Control...
motor controlcode generationpower managementvehicle dynamicspower electronicscommercial modelselectric vehiclessoftware validationdesign calculationssystem requirementscontrols developmentproduct specification*
About Accenture: Accenture is a leading global professional services company, providing a broad range of services in strategy and consulting, interactive, technology and operations, ...
embedded cmicrocontrollerprogrammingdebugginggsmaccount managementclient relationshipbusiness developmentsoftware engineeringprofessional servicesvisitdesignmatlabactingdspaceautosarYour responsibilities:
© 2019 Hireejobs All Rights Reserved