federal government jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

federal government Job Openings

Showing 101 - 150 of 4305 Jobs

Head - Finance & Accounts

JOBS HELP CONSULTANCY 1.00 to 10.00 Years Hyderabad, IndoreIndore, Lucknow, Kolkata, Pune, Delhi, Haridwar 28 Jul, 2026

Head - Finance & Accounts

General Manager - Operations

DIGITALCUBE CONSULTANCY SERVICES PRIVATE LIMITED 1.00 to 10.00 Years Surat 28 Jul, 2026

Job Description

Designation

Experience Required

Location

Key Respons...
financial planningmis reportingngo operations

Resident Construction Manager
AI MZ-Tech Consultant 1.00 to 10.00 Years Gurugram, DelhiDelhi, Bangalore, Chennai, Kurnool, Hyderabad, Kolkata, Pune, Kakinada, Mumbai City 28 Jul, 2026

Resident Construction Manager Resident Construction Manager (RCM) Education B.E / B.Tech or Diploma ( Electrical / Civil ) Experience 10 - 15 years Location Project sites at ...
residentialresident activitiesresidential cleaningresidency programsresidential salesresidence liferesidential careresinresidential additions

Agricultural Mechanics
AYURSMITH WELLNESS (OPC) PRIVATE LIMITED 1.00 to 10.00 Years Gurugram, DelhiDelhi, Oman, Qatar, Guntur, Bangalore, Chennai, Kurnool, United Arab Emirates, Hydera 28 Jul, 2026

An Agricultural Engineering & Mechanics professional datanurseryemergencynaturalwaterengineeringcollectionqualitymaintenancetechnicalassistanceequipmentconservationpracticesharvestresources

Patient Welfare Officer
Needs Ayurveda Private Limited 1.00 to 10.00 Years Erode, TuticorinTuticorin, Bangalore, Kozhikode, Hyderabad, Kolkata, Pune, Mangalore, Bilaspur, Ratl 28 Jul, 2026

Patient Welfare Officer acts as a vital bridge between patients and hospital management. They are responsible for ensuring holistic patient well-being by gathering feedback, resolving complaints,...
patiencemedical terminologyemotional intelligencemedical recordspatient relationsstress managementpatient advocacypatient rightshealthresilienceelectronic

Requirement for Chemistry,Organic Chemeistry,Biochemeistry Graduates
ACHIEVERS SPOT Hiring For Medical Coding 1.00 to 10.00 Years Erode, MaduraiMadurai, Coimbatore, Chennai, Ramanathapuram, Pudukottai, Kanyakumari, Hosur, Dharmapu 28 Jul, 2026

DESCRIPTION
As a Zoologist in Chennai, you will study animals and their behavior, habitats, and ecosystems. You will be involved in research, conservation efforts, an...
nursingbiomedicalbiotechnologymedical codingpharmabioinformaticsbiochemistrybiology

Medical Coding
ACHIEVERS SPOT Hiring For MEDICAL CODING 1.00 to 10.00 Years Erode, MaduraiMadurai, Tiruchirappalli, Chennai, Thirunelveli, Salem, Nagercoil, Tuticorin, Cuddalor 28 Jul, 2026

A physiotherapybiotechnologymedical codingmicrobiologybioinformaticsnursingpharmacybiomedicalmedical lab technology

Resident Construction Manager
AI MZ-Tech Consultant 1.00 to 10.00 Years Delhi, BangaloreBangalore, Chennai, Kurnool, Hyderabad, Kolkata, Gurugram, Pune, Kakinada, Mumbai Ci 28 Jul, 2026

Resident Construction Manager Resident Construction Manager (RCM) Education B.E / B.Tech or Diploma ( Electrical / Civil ) Experience 10 - 15 years Location Project sites at ...
residentialresident activitiesresidential cleaningresidency programsresidential salesresidence liferesidential careresinresidential additions

Agricultural Specialist
AYURSMITH WELLNESS (OPC) PRIVATE LIMITED 1.00 to 10.00 Years Delhi, NoidaNoida, Oman, Qatar, Saudi Arabia, Bangalore, Philippines, Chennai, Kurnool, United Arab 28 Jul, 2026

A park ranger safetyemergencypubliccollectionreservationsservicepatrolcustomerinterpretivefeesituationsvisitorprogramsrangersservices

Accountant Manager
The Asian International University 1.00 to 10.00 Years Delhi, GhaziabadGhaziabad, Noida 28 Jul, 2026

We are seeking a detail-oriented and organized Accountant to join our finance team. The accountant will manage financial records, prepare accurate reports, ensure compliance with regulations, and...
tax calculationteam handlingfinancial managementauditing

Payroll Administrator
FW FUTURESWINGS PRODUCTS & SERVICES (OPC) PRIVATE LIMITED 1.00 to 10.00 Years Chandigarh, PurniaPurnia, Bangalore, Chennai, Hyderabad, Chittoor, Gurugram, Kolkata, Delhi, Patna 28 Jul, 2026

A Payroll Administrator communicationconfidentialitytechnical proficiency

SAS Trainer Freelance
WebTech Software Solutions 1.00 to 10.00 Years Chennai, BangaloreBangalore, Hyderabad, Mumbai City 28 Jul, 2026

Effectively Conduct Training for Fresh Graduate Students , Corporate Professional , Corporate , Government Agencies on SAS All SAS Trainer are required to provide training based on SAS official...
sas sqlsassas web report studiosas macrossas di studiosas bi

Maintenance Head
JOBS HELP CONSULTANCY 1.00 to 10.00 Years Ahmedabad, NashikNashik, Bhubaneswar, Dehradun, Lucknow, Kolkata, Jamshedpur, Pune, Delhi, Bhopal 28 Jul, 2026

Maintenance Head - 1-Over all plant maintenance mechanical, electrical and civil(mepc). 2-Preventive maintenance of machine equipment. 3-Minimum break down time and maximum m...
machine maintenancemechanical maintenancemaintenanceutility maintenanceplant maintenance

Project Head - Real Estate/Construction
HR JOBS CONSULTANCY 1.00 to 10.00 Years Vadodara, NashikNashik, Bangalore, Indore, Lucknow, Gurugram, Kolkata, Jamshedpur, Pune, Barmer 22 Jul, 2026

Project Head - Real Estate/Construction Role: Project Head (Real Estate / Construction) Reporting To : Managing Director / CEO / COO Job Purpose: project managementproject executionproject planning

Food Science & Processing
AYURSMITH WELLNESS (OPC) PRIVATE LIMITED 1.00 to 10.00 Years Tirupati, ChennaiChennai, Hyderabad, Kurnool, Qatar, Bangalore, Kuwait, Noida, Philippines, United A 22 Jul, 2026

A Food Science & Processing professional culinarytrialssupporttechnicalspecificationsdevelopmentmanagementsafetyfoodprojectpilotplantproduct

Fire & Safety Supervisor
A-ONE STAFFING 1.00 to 10.00 Years Surat, KochiKochi, Rudrapur, Pune, Panipat, Patna 22 Jul, 2026

Urgent Requirements Post - fire and Safety Supervisor Experience - 0 to 5yr Salary - 20,000 to 40,000 Location - Pune, Panipat, Kochi, Rudrapur, Surat, Patna Site - Industri...
safety auditsafety trainingfire protectionsafety case developmentfire alarm systemsafety engineeringsafety officer activitiesfire safetysafety implementation

General Manager - Plant Operations & Administration
JOBS HELP CONSULTANCY 1.00 to 10.00 Years Raipur, NoidaNoida, Indore, Hyderabad, Kolkata, Pune, Chakan, Bawal, Ankleshwar, Solan 22 Jul, 2026

General Manager - Plant Operations & Administration Job description Responsible for general administration of the Plant Liaising with external government bodi...
plant operationsprocess managementproduction managementliaisoningppccommercial operations

||Urgent Hiring For ||Tender Executive ||Location Tilak Nagar, New Delhi ||
Orbitouch Outsourcing Private Limited 1.00 to 10.00 Years Delhi 22 Jul, 2026

||Urgent Hiring For ||Tender Executive ||Location: Tilak Nagar, New Delhi || Company:Orbitouch Outsourcing Private Limited Profile :- Tender Executive (only Female) Location:Ti...
bid managementtenderingbid preparationtender managemente-procurementprocurementcppp

Accountant Manager
The Asian International University 1.00 to 10.00 Years Noida, DelhiDelhi, Ghaziabad 22 Jul, 2026

We are seeking a detail-oriented and organized Accountant to join our finance team. The accountant will manage financial records, prepare accurate reports, ensure compliance with regulations, and...
tax calculationteam handlingfinancial managementauditing

Chief Security Officer (CSO)
JOBS HELP CONSULTANCY 1.00 to 10.00 Years Noida, DelhiDelhi, Lucknow, Bangalore, Indore, Hyderabad, Jamshedpur, Pune, Bhopal, Patna 22 Jul, 2026

Chief Security Officer (CSO) Key Responsibilities Develop and execute enterprise-wide security strategy covering physical security Oversee security of project sites, plants, e...
security auditssecurity servicessecurity compliancesecurity operations

Medical Coding Analyst
ACHIEVERS SPOT Hiring For MEDICAL CODING 1.00 to 10.00 Years Madurai, TiruchirappalliTiruchirappalli, Erode, Chennai, Thirunelveli, Salem, Nagercoil, Tuticorin, 22 Jul, 2026

Position:Medical Coder About Achievers Spot Medical Coding is the Fastest-growing Profession in the Healthcare Industry Today. It is a Niche Specialization and...
physiotherapybiotechnologymedical codingbiomedicalpharmacynursingmedical lab technologymedical coding analystmedical coding executive

Medical Coding Analyst
ACHIEVERS SPOT Hiring For MEDICAL CODING 1.00 to 10.00 Years Madurai, TiruchirappalliTiruchirappalli, Erode, Chennai, Thirunelveli, Salem, Nagercoil, Tuticorin, 22 Jul, 2026

Position:Medical Coder About Achievers Spot Medical Coding is the Fastest-growing Profession in the Healthcare Industry Today. It is a Niche Specialization and...
physiotherapybiotechnologymedical codingbiomedicalpharmacynursingmedical lab technologymedical coding analystmedical coding executive

Plant Safety Manager
TALENTCO HR SERVICES LLP 1.00 to 10.00 Years Navi Mumbai, Mumbai City 22 Jul, 2026

Job Title: Plant Safety Manager
Job Description
The Plant Safety...
risksafetyemergencyhseinvestigationhealthmanufacturingauditassessmentehsindustrialaccidentplantoccupationalmanager

Project Head - Real Estate/Construction
HR JOBS CONSULTANCY 1.00 to 10.00 Years Lucknow, NashikNashik, Bangalore, Indore, Gurugram, Kolkata, Jamshedpur, Pune, Vadodara, Barmer 22 Jul, 2026

Project Head - Real Estate/Construction Role: Project Head (Real Estate / Construction) Reporting To : Managing Director / CEO / COO Job Purpose: project managementproject executionproject planning

Fire & Safety Supervisor
A-ONE STAFFING 1.00 to 10.00 Years Kochi, RudrapurRudrapur, Pune, Surat, Panipat, Patna 22 Jul, 2026

Urgent Requirements Post - fire and Safety Supervisor Experience - 0 to 5yr Salary - 20,000 to 40,000 Location - Pune, Panipat, Kochi, Rudrapur, Surat, Patna Site - Industri...
safety auditsafety trainingfire protectionsafety case developmentfire alarm systemsafety engineeringsafety officer activitiesfire safetysafety implementation

General Manager - Plant Operations & Administration
JOBS HELP CONSULTANCY 1.00 to 10.00 Years Indore, NoidaNoida, Raipur, Hyderabad, Kolkata, Pune, Chakan, Bawal, Ankleshwar, Solan 22 Jul, 2026

General Manager - Plant Operations & Administration Job description Responsible for general administration of the Plant Liaising with external government bodi...
plant operationsprocess managementproduction managementliaisoningppccommercial operations

Project Head - Real Estate/Construction
HR JOBS CONSULTANCY 1.00 to 10.00 Years Indore, NashikNashik, Bangalore, Lucknow, Gurugram, Kolkata, Jamshedpur, Pune, Vadodara, Barmer 22 Jul, 2026

Project Head - Real Estate/Construction Role: Project Head (Real Estate / Construction) Reporting To : Managing Director / CEO / COO Job Purpose: project managementproject executionproject planning

Chief Security Officer (CSO)
JOBS HELP CONSULTANCY 1.00 to 10.00 Years Indore, BhopalBhopal, Bangalore, Noida, Hyderabad, Lucknow, Jamshedpur, Pune, Delhi, Patna 22 Jul, 2026

Chief Security Officer (CSO) Key Responsibilities Develop and execute enterprise-wide security strategy covering physical security Oversee security of project sites, plants, e...
security auditssecurity servicessecurity compliancesecurity operations

SAS - Online Trainer
WebTech Software Solutions 1.00 to 10.00 Years Hyderabad, BangaloreBangalore, Chennai, Mumbai City 22 Jul, 2026

Effectively Conduct Training for Fresh Graduate Students , Corporate Professional , Corporate , Government Agencies on SAS All SAS Trainer are required to provide training based on SAS official...
sas sqlsassas web report studiosas macrossas di studiosas bi

Agricultural Mechanics
AYURSMITH WELLNESS (OPC) PRIVATE LIMITED 1.00 to 10.00 Years Guntur, ChennaiChennai, Hyderabad, Kurnool, Guntakal, Oman, Qatar, Bangalore, United Arab Emirates, 22 Jul, 2026

An Agricultural Engineering & Mechanics professional datanurseryemergencynaturalwaterengineeringcollectionqualitymaintenancetechnicalassistanceequipmentconservationpracticesharvestresources

Agricultural Specialist
AYURSMITH WELLNESS (OPC) PRIVATE LIMITED 1.00 to 10.00 Years Gurugram, DelhiDelhi, Noida, Oman, Qatar, Saudi Arabia, Bangalore, Philippines, Chennai, Kurnool, Un 22 Jul, 2026

A park ranger safetyemergencypubliccollectionreservationsservicepatrolcustomerinterpretivefeesituationsvisitorprogramsrangersservices

Project Head - Real Estate/Construction
HR JOBS CONSULTANCY 1.00 to 10.00 Years Gurugram, NashikNashik, Bangalore, Indore, Lucknow, Kolkata, Jamshedpur, Pune, Vadodara, Barmer 22 Jul, 2026

Project Head - Real Estate/Construction Role: Project Head (Real Estate / Construction) Reporting To : Managing Director / CEO / COO Job Purpose: project managementproject executionproject planning

Chief Security Officer (CSO)
JOBS HELP CONSULTANCY 1.00 to 10.00 Years Lucknow, NoidaNoida, Delhi, Bangalore, Indore, Hyderabad, Jamshedpur, Pune, Bhopal, Patna 22 Jul, 2026

Chief Security Officer (CSO) Key Responsibilities Develop and execute enterprise-wide security strategy covering physical security Oversee security of project sites, plants, e...
security auditssecurity servicessecurity compliancesecurity operations

Medical Coding
ACHIEVERS SPOT Hiring For MEDICAL CODING 1.00 to 10.00 Years Erode, MaduraiMadurai, Tiruchirappalli, Chennai, Thirunelveli, Salem, Nagercoil, Tuticorin, Cuddalor 22 Jul, 2026

Position:Medical Coder About Achievers Spot Medical Coding is the Fastest-growing Profession in the Healthcare Industry Today. It is a Niche Specialization and...
medical codingpharmacyphysiotherapymicrobiologybiotechnologybiomedicalnursingbioinformaticsmedical lab technology

Patient Welfare Officer
Needs Ayurveda Private Limited 1.00 to 10.00 Years Erode, TuticorinTuticorin, Bangalore, Kozhikode, Hyderabad, Kolkata, Pune, Mangalore, Bilaspur, Ratl 22 Jul, 2026

Patient Welfare Officer acts as a vital bridge between patients and hospital management. They are responsible for ensuring holistic patient well-being by gathering feedback, resolving complaints,...
patiencemedical terminologyemotional intelligencemedical recordspatient relationsstress managementpatient advocacypatient rightshealthresilienceelectronic

Wanted B pharm Fresher For Medical Coding
ISKILLS SOLUTIONS 1.00 to 10.00 Years Chennai, VelloreVellore, Viluppuram, Tiruchengode, Thoothukudi, Salem, Nagercoil, Dindigul, Neyveli, 22 Jul, 2026

Role- Medical Coder: We are looking to hire an fresher Coder (B Pharm, Microbiology, Biology etc.)With strong domain expertise in CPT and ICD (diagnosis) coding, the incumbent should be able to v...
radiologycardiologyanesthesianursingdialysisbiologyzoologybiochemistry

Dcs Engineer
UNInternational 1.00 to 10.00 Years Ahmedabad, BhubaneswarBhubaneswar, Chennai, Hyderabad, Kolkata, Vishakhapatnam 22 Jul, 2026

Responsibilities:

Review of all documentation assigned by the commissioning manager such as; drawings, lists, calculations, procedures, instructions, protection/control...
commissioningdcscombustionturbine

Purchase Manager
Dhruv Corporate (HR) Solutions Pvt Ltd 1.00 to 10.00 Years Ahmedabad 22 Jul, 2026

Job Title: Purchase Manager Location: Ahmedabad Salary: 6 7 LPA Job OverviewWe are looking for an experienced and detail-orientedPurchase Managerto manage end-to-end procure...
managementvendor managementprocurementgrncoststores

Python / Spark Developer Associate Software Engineering (Maharashtra)
Morgan Stanley 1.00 to 10.00 Years All India 20 Jul, 2026

Profile Description We re seeking someone to join our team as Python Developer as a part of our FRPPE- FinTech team to will play a key role in helping transform how Morgan Stanley operates FRRPE T...
PythonSparkData WarehousingSQLUnix shell scriptingDevOpsContinuous IntegrationTest AutomationBuild Automation

National Sales Manager Medical Devices & IC , Government Business
Talent Leads HR Solutions Pvt Ltd 1.00 to 10.00 Years Lucknow, Delhi 20 Jul, 2026

Purpose The purpose of the National Sales Manager (NSM) Government Business is to lead and drive the organizations government sales strategy, ensuring sustainable revenue growth...
salesmedical devices

Looking for Institutional Sales Manager - Diagnostics for Thane and Panvel
JobFlip 1.00 to 10.00 Years Navi Mumbai, ThaneThane, Panvel 20 Jul, 2026

We are urgntly looking for a Institutional Sales Manager - Diagnostics for Thane and Panvel location. Interested candidates can call me on hidden_m...
business developmentmarket analysisaccount managementdiagnosticsinstitutional salessales growthsales strtegy execution

National Sales Manager For Medical Device based at Delhi
Talent Leads HR Solutions Pvt Ltd 1.00 to 10.00 Years Delhi 20 Jul, 2026

Role Scope: The National Sales Manager (NSM) Government Infection Control (IC) is responsible for leading the company's government sales strategy, driving business growth through Central and ...
government salesmedical devices

US Payment Merchant Taxation Operations Analyst Bangalore
WHITE HORSE MANPOWER CONSULTANCY (P) LTD 1.00 to 10.00 Years Bangalore 20 Jul, 2026

Job Description (JD)
reconciliationtax compliancefinancial operationsbanking operationslevy processingfinopspayment taxationirs noticesus payments

Senior Analyst
FNF India Private Limited 1.00 to 10.00 Years Bangalore 20 Jul, 2026

WALK-IN DRIVE | Senior Analyst | Operations | 2-6 Years | Tuesday 21st Were Hiring! Join a leading organization and build your career in Operations.

Position: document verificationtitle searchms officetitle searchesowner searchdata entry order processingcurrent owner search

Executive / Sr. Executive / Assistant Manager (Marketing)
MORASH CROP SCIENCE PRIVATE LIMITED 1.00 to 10.00 Years Delhi 20 Jul, 2026

We are looking for dynamic and result-oriented professionals for our Marketing Team in the Pesticides industry. Position: Executive / Sr. Executive / Assistant Manager Marketing...
field workcomputer operating

Senior Manager - Marketing (Micronutrients)
DIGITALCUBE CONSULTANCY SERVICES PRIVATE LIMITED 1.00 to 10.00 Years Chennai, HyderabadHyderabad, Kolkata 20 Jul, 2026

Were Hiring: Senior Manager Marketing (Micronutrients) Location: Chennai (Preferred) / Hyderabad / Kolkata Experience: 11 to 15 Years Salary: distribution managementb2b salesmarketingbusiness developmentagrochemical salesmicronutrientsfertilizer sales

Sales and Tender Executive
MAYVENT MANAGEMENT PRIVATE LIMITED 1.00 to 10.00 Years Navi Mumbai, ThaneThane, Mumbai City 20 Jul, 2026

Were Hiring | Sales & Tender Executive Location: Mumbai Experience: 2-5 Years CTC: Up to 5 LPA Were looking for a proactive Sales & Tender Executive to manage tender submissions, sales coordi...
cppportaltendersales coordinationgem

Human Resource Head
BHARTI HR CLEANER WALA ZEEVIKA JOBS Hiring For SS Medicals 1.00 to 10.00 Years Lucknow 20 Jul, 2026

Urgent Hiring | HR Head | Lucknow | Up to 16 LPA

Job Title HR Head Location: Lucknow, Uttar Pradesh Experience: 9 - 14 Years talent acquisitionhr generalist activitieshr operationspolicy formulationtalent managementrecruitment managementhr compliance

Data Science Project/Process Advisor
Federal Express Corporation AMEA 1.00 to 10.00 Years Chennai 20 Jul, 2026

Job Summary: Takes ownership over select data science initiatives. Advances ACCs broad capabilities to use and deploy cutting edge data science and machine learning tools and methods in ACCs proj...
LeadershipProject ManagementAnalytical SkillsData ScienceOperations ResearchVerbal CommunicationWritten CommunicationOrganizational SkillsProblemSolving Skills

Call Center Customer Service Representative
Green Plastwood Pvt Ltd 1.00 to 10.00 Years Ahmedabad 20 Jul, 2026

Were Hiring: Call Center Customer Service Representative Address: 13th Floor, SNG ECO INDIA PVT LTD, Fortune Business Hub, 1313, 1314, Sola Rd, Science City, Ahmedabad, Gujarat 380060 Company: ...
salescommunicationlead generationcustomer servicetelecalling

PREV
NEXT

federal government Job Openings

DESCRIPTION

Job Description

Job Description (JD)

Were Hiring: Senior Manager Marketing (Micronutrients) Location: Chennai (Preferred) / Hyderabad / Kolkata Experience: 11 to 15 Years Salary: distribution managementb2b salesmarketingbusiness developmentagrochemical salesmicronutrientsfertilizer sales

Urgent Hiring | HR Head | Lucknow | Up to 16 LPA

Job Title HR Head Location: Lucknow, Uttar Pradesh Experience: 9 - 14 Years talent acquisitionhr generalist activitieshr operationspolicy formulationtalent managementrecruitment managementhr compliance

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers